Was heißt Solidarität in der Corona-Ära?

Auch mehr Patienten ohne COVID werden wegen Überlastung der Krankenhäuser sterben

Das nasse und kalte Herbstwetter fördert die Verbreitung von Erkältungsviren. Dementsprechend steigen nun auch wieder die Infektionszahlen für das Coronavirus.

Nach wie vor gelten Impfungen als bester Schutz vor einem schweren COVID-Verlauf. Laut Bundesgesundheitsministerium sind jetzt (1. November) rund 85 Prozent der Deutschen ab 60 Jahren vollständig geimpft. Bei den 18- bis 59-jährigen sind es 73 Prozent und bei den 12- bis 17-jährigen 42 Prozent.

Allerdings gibt es auch große regionale Unterschiede: So bleiben Sachsen (57 Prozent), Brandenburg und Thüringen (jeweils 61 Prozent) die Schlusslichter. Bremen liegt mit 78 Prozent an der Spitze, gefolgt vom Saarland (73 Prozent), Hamburg und Schleswig-Holstein (jeweils 72 Prozent). Es gibt ein deutliches Nordwest-Südost-Gefälle.

Ein provokanter Vorschlag

Am 25. Oktober schrieb ich hier über eine neue Studie zur Berechnung der Sterblichkeit (Corona-Jahr 2020: “Untersterblichkeit” in Deutschland). Darin machte ich einen provokanten Diskussionsvorschlag: Warum nicht Menschen, die ohne medizinische Notwendigkeit auf die Impfung verzichten, an den Behandlungskosten beteiligen, falls sie später wegen COVID ins Krankenhaus müssen und sie sich das finanziell leisten können?

Am häufigsten wurde mir daraufhin von Leserinnen und Lesern die Abkehr vom Solidaritätsprinzip vorgeworfen. Manche zogen Vergleiche, dass man dann Menschen auch bei riskanten Hobbys an den Folgekosten beteiligten müsse (etwa beim Skifahren außerhalb vorgegebener Pisten). Ein Leser meinte, mich in einer Privatnachricht als “Faschisten” bezeichnen zu müssen.

Dabei hatte ich unterstrichen: Alle werden behandelt. Niemand wird aufgrund seines Impfstatus abgewiesen.

Krise im Gesundheitssystem

Stellen wir dem die Situation im Pflege- und Gesundheitssystem gegenüber: Das Personal steht auch zu normalen Zeiten oft unter Stress. Marktwirtschaftlicher Kostendruck, Fachkräftemangel und alternde Gesellschaft lassen grüßen. Durch die Zunahme an COVID-Behandlungen wurde nicht nur das Personal weiter belastet, sondern mussten andere Behandlungen aufgeschoben werden.

Eine neue Studie von Krebsforschern unter Beteiligung des Universitätsklinikums Tübingen hat jetzt ergeben, dass durch die Pandemie weltweit jede siebte potenziell lebensrettende Tumoroperation abgesagt werden musste. So ein bösartiger Tumor kann dann im ganzen Körper Metastasen bilden.

Dadurch wird die Folgebehandlung wesentlich schwieriger, vielleicht sogar ganz aussichtslos. Viele dieser Menschen weilen nun wahrscheinlich nicht mehr unter uns. Sie sind gestorben, weil sie nicht (rechtzeitig) operiert werden konnten. Ihre Angehörigen trauern um den unwiederbringlichen Verlust.

In meinem Bekanntenkreis gibt es so einen Fall: Der Vater einer Bekannten hatte lange Zeit schwere Darmprobleme. Im Krankenhaus gab es aber wegen COVID keinen freien Behandlungstermin. Erst als sich der Hausarzt mit größter Mühe dafür einsetzte, fand eine Untersuchung statt.

Ergebnis: Darmkrebs mit Metastasen. Inzwischen leider zu spät für eine Behandlung. Die Familie bereitet sich jetzt auf den bevorstehenden Tod des Vaters vor. Dazu ein Zitat von Dr. Markus Löffler, einem der Studienautoren, über die Tumoroperationen:

“Es ist zu erwarten, dass die veränderte Versorgungssituation während der Pandemie, die durch Ergebnisse unserer Studie belegt ist, auch zukünftig Auswirkungen haben wird. Entsprechend kann man damit rechnen, dass durch Verschiebungen und verminderte Inanspruchnahme von Vorsorgeuntersuchungen während der Pandemie fortgeschrittene Krebserkrankungen auch in Deutschland verstärkt auftreten werden.”

Dr. Markus Löffler, Tansplantationschirurg am Universitätsklinikum Tübingen und einer der deutschen Leiter des COVIDSurg Forschungsnetzwerks

Da auch hier in den Niederlanden die Anzahl der positiven Coronatests und der Krankenhausaufnahmen wieder steigt, wendeten sich gestern die Leiter der acht Intensivstationen der Universitätskliniken mit einem Brandbrief an die Medien: Das Wasser stehe ihnen bis zum Hals. Aufgrund zunehmender COVID-Behandlungen gebe es bald zu wenige Betten zur Behandlung von Unfallopfern oder nach Herz- und Krebsoperationen.

Mit großer Mühe will man die Triage vermeiden: Wen behandelt man, wen behandelt man nicht? Bei der Terminvergabe von Untersuchungen und Operationen findet aber – schlicht aufgrund begrenzter Möglichkeiten – schon eine Auswahl statt. Diese Auswahl führt in manchen Fällen zum unnötigen Tod von Menschen.

Stellen wir dem die häufigsten Nebenwirkungen der Corona-Impfungen entgegen: vorübergehende Schmerzen an der Einstichstelle im Arm und etwas Müdigkeit.

Und jetzt stelle ich noch einmal die Frage: Welches Verhalten ist hier solidarisch, welches unsolidarisch?

Zu den Impfnebenwirkungen

An dieser Stelle führen die Gegner der Impfungen oft die Möglichkeit von Langzeitschäden an. Natürlich kann man nach rund einem Jahr noch nicht wissen, welche Folgen eine Impfung vielleicht nach fünf oder zehn Jahren haben wird.

Dass die Zulassungsverfahren beschleunigt wurden, lag an der rasanten Ausbreitung der neuen Coronaviren rund um den Globus. Verfahrensschritte, die sonst (also wenn es weniger eilt) hintereinander stattfinden, führte man jetzt gleichzeitig aus. Das ist doch ein Fortschritt: Den so oft wegen ihrer Trägheit kritisierten bürokratischen Mühlen hat man Beine gemacht. Wo ein Wille ist, ist auch ein Weg.

Zudem wurden Impfprotokolle laufend angepasst, wenn es bei einer bestimmten Gruppe zu einigen (im Gesamtbild aber immer noch sehr seltenen) schweren Nebenwirkungen kam. Niemand kann also behaupten, Nebenwirkungen würden nicht ernst genommen.

Andere Kritiker verweisen auf Verträge mit den Impfherstellern, in denen die Risiken möglicher Langzeitfolgen von den Regierungen übernommen werden. Erst einmal war es wahrscheinlich ungeschickt, diese Verträge (wieder einmal) geheimhalten zu wollen. Das befeuerte Verschwörungstheorien.

Diese Vertragsklausel ist aber kein Indiz dafür, dass es tatsächlich (noch unbekannte) Langzeitschäden gibt. Es ist schlicht unternehmerische Logik, möglichen Schaden vom Unternehmen fernzuhalten.

Die Pharmaindustrie ist bekanntermaßen kein Wohlfahrtsverein, sondern ein Multimilliardenbusiness. Jedoch ein Business, von dem auch viele Patientinnen und Patienten profitieren, wenn sie Medikamente brauchen. Dass man darum nicht alles schlucken sollte, steht auf einem anderen Blatt.

Schließlich spricht auch Wissen um die Wirkungsweise der Impfstoffe gegen Spätfolgen. Die verabreichten Dosen sind sehr gering und in der Regel nach wenigen Tagen vollständig abgebaut. Darum treten die Nebenwirkungen, die es gibt, vor allem kurz nach der Impfung auf. Durch den Impfstoff lernt das Immunsystem besser, das Virus zu erkennen und dann zu bekämpfen.

Schlussfolgerung

Fassen wir zusammen: Langzeitfolgen der Impfungen lassen sich nie zu 100 Prozent ausschließen, sind beim heutigen Kenntnisstand aber unwahrscheinlich. Demgegenüber wissen wir heute bereits, dass die Impfungen das beste verfügbare Mittel gegen schwere COVID-Verläufe sind.

Außerdem wissen wir heute bereits, dass schwere COVID-Verläufe das Gesundheitssystem stark belasten und weiter belasten werden. Dadurch müssen andere Behandlungen verschoben werden. Viele Patientinnen und Patienten auf der ganzen Welt sind darum bereits gestorben und mehr werden deshalb sterben.

Daher noch einmal meine Frage: Welches Verhalten ist hier solidarisch? Sich nicht nur für das eigene Wohl, sondern auch im Interesse des Pflegepersonals und fürs Leben von anderen Menschen zwei-, vielleicht dreimal piksen zu lassen? Wofür die allermeisten Menschen nur vorübergehende Muskelschmerzen und Müdigkeit erfahren werden?

Oder weiter rein spekulativ an eine Verschwörung oder Spätfolgen der Impfungen glauben? Und dabei in Kauf nehmen, dass das Gesundheitssystem mit seinem Personal, seinen schwerkranken Patientinnen und Patienten weiter überlastet wird? Und Menschen unnötig sterben, ihre Angehörigen in tiefer Trauer sein werden?

Ich bin nach wie vor gegen eine Impfpflicht – im Interesse des sozialen Friedens (Wie wahrscheinlich ist eine Coronavirus-Impfpflicht?). Ich halte nach wie vor G3-Regeln für sinnvoller als G2 – der 20. Deutsche Bundestag hat es bei seiner konstituierenden Sitzung letzte Woche vorgemacht. Für einige Abweichler von der AfD gab es sogar Sitzplätze auf der Zuschauertribüne.

Mein Vorschlag lief darauf hinaus, erwachsene Menschen nach Monaten der Information, Diskussion und Verfügbarkeit der Impfstoffe für die finanziellen Folgen ihrer Entscheidung verantwortlich zu machen – wenn sie sich das leisten können. Das bedeutet gerade, diese Menschen ernst zu nehmen, anstatt sie zu bevormunden.

Hinweis: Dieser Beitrag erscheint vielleicht auch auf Telepolis. Titelgrafik: geralt auf Pixabay.

Veröffentlicht von

www.schleim.info

Die Diskussionen hier sind frei und werden grundsätzlich nicht moderiert. Gehen Sie respektvoll miteinander um, orientieren Sie sich am Thema der Blogbeiträge und vermeiden Sie Wiederholungen oder Monologe. Beim Gedankenaustausch darf es auch mal heiß hergehen, jedoch nicht beleidigend werden, vor allem nie unter die Gürtellinie gehen. Stephan Schleim ist studierter Philosoph, Psychologe und promovierter Kognitionswissenschaftler. Seit 2009 ist er an der Universität Groningen in den Niederlanden, zurzeit als Assoziierter Professor für Theorie und Geschichte der Psychologie. Der Autor schreibt auch für zahlreiche andere Medien.

137 Kommentare

  1. @Schleim
    Sie haben sehr richtig darauf hingewiesen, dass die Schnelligkeit der Zulassung nur ein Organisationsproblem ist – und nichts mit der Qualität des Impfstoffs zu tun hat.
    Des weiteren haben Sie beschrieben, dass die Notfallzulassung nur ein organistorisches bzw. versicherungstechnisches Problem ist und nichts mit der Qualität des Impfstoffs zu tun hat.

    Nur mit solchen Sachinformationen kann man Impfgegner dazu bewegen, sich impfen zu lassen – zumindest diejenigen, welche einer Sachinformation zugänglich sind.
    Deswegen denke ich, dass es das Beste ist, mit Argumenten zu arbeiten damit zögernde Menschen sich doch noch impfen lassen.

    Was evenuell auch noch helfen könnte, wäre es, wenn in den Medien verstärkt öfter über das Leiden von Long-Covid-Patienten berichtet würde – dann würden viele Menschen darüber nachdenken ob man das Risiko einer Infektion wirklich haben möchte.

    Ein Beispiel dazu: Ein Arbeitskollege ist (ca. 55 Jahre) ist so schwer an Covid erkrankt, dass er nun berufsunfähig ist. Weil er Hauptverdiener ist, bedeutet dies dass das Familieneinkommen deutlich geringer wird – und man zusätzlich zu seinen gesundheitlichen Langzeitproblemen später auch noch mit einer niedrigen Rente auskommen muss

  2. Das ist ein schwieriges und kontroverses Thema. Ich selber habe vor kurzem vorgeschlagen, eine unbegründete Impfverweigerung als fahrlässige Körperverletzung zu werten. Der Vorschlag wurde von Ihnen, Herr Stephan, rüde abgelehnt. Natürlich können auch Geimpfte infiziert werden und das VIrus folglich weitergeben, allerdings mit geringerer Viruslast und entsprechend milderen Symptomen.

    Müsste man dann nicht auch Alkoholiker, Extremsportler, Abenteurer, Leichtsinnige, Fettsüchtige, Autoraser u.v.a. der Unsolidarität bezichtigen? Die meisten Mensche sind auf die eine oder andere Art unsolidarisch. Eine vernünftigere Alternative zur Beteiligung an Behandlungskosten wäre eine höhere Prämie für die Krankenversicherung, analog der Teil- und Vollkaskoversicherung für das Auto, bzw. der Staffelung der Versicherung nach Unfallhäufigkeiten oder Motorleistung. Eine Beteiligung an Behandlungskosten wäre sinnlos bei Zahlungsunfähigkeit, z.B. wegen der Höhe der Kosten.

  3. Nur am Rande, terminologisch: Man sollte Langzeitfolgen und Spätfolgen auseinanderhalten. Wenn jemand infolge einer Impfung einen anhaltenden Impfschaden erleidet, ist das eine Langzeitfolge. Die gibt es unstrittig bei der Coronaimpfung. Strittig ist, ob es auch Spätfolgen in dem Sinne gibt, dass eine Schädigung erst Monate oder gar Jahre nach der Impfung auftritt. Damit ist nach allem, was man bisher weiß, nicht zu rechnen.

    Was die Beteiligung an den Behandlungskosten angeht: Das Verschuldensprinzip ist der GKV systemfremd. Das zu ändern, provoziert sofort weitreichende Gleichbehandlungsfragen (auch bei nicht vorliegender Influenzaimpfung? auch für Raucher/innen? auch bei rückfälligen Alkoholiker/innen? usw.) und hätte unter Umständen zudem heikle Folgen im Einzelfall, wenn z.B. die Beteiligung so hoch angesetzt wird, dass Familien mitbetroffen sind.

    Jenseits der Behandlungskosten: Die Frage, wie viel Solidarität man von Menschen einfordern darf, wenn das mit Gesundheitsrisiken für die eigene Person verbunden ist, wie gering sie auch sein mögen, ist auch ethisch nicht einfach. Aber wenn man die Impfung als Solidarleistung mit harten Maßnahmen einfordert, um Widerstände zu brechen, warum dann nicht doch eine Impfpflicht?

    Vordringlich wäre, jetzt die noch bestehenden Impflücken in der Altersgruppe 60+ zu schließen und vor allem in den Heimen dafür zu sorgen, dass die Pflegekräfte und die Bewohner/innen geimpft sind. Die Auffrischimpfungen in den Heimen scheitern übrigens nicht an Impfgegnern.

  4. @KRichard: Fakten, Konsequenzen, Werte

    Ja – aber ich denke, wer sich jetzt noch nicht hat impfen lassen, der ist Fakten eher nicht zugänglich.

    Man kann dann noch über Werte sprechen.

    Ich habe es hier über die Konsequenzen versucht – insbesondere das Leiden für andere.

  5. @Reutlinger: Das Strafrecht ist das härteste Schwert des Staates – damit sollte man selbst nicht fahrlässig umgehen.

    Ich erinnere mich nicht, ob Sie wirklich von fahrlässiger Körperverletzung sprachen. Sei’s drum. Für eine Strafverfolgung müsste es meines Wissens aber auch einen konkreten Tatvorgang geben. Jemanden nur für ein erhöhtes Risiko zu verurteilen, ist noch einmal eine ganz andere Hausnummer.

    Wie dem auch sei: Wenn jemand z.B. weiß, dass er Corona-positiv ist und dann z.B. (auf einer Demo) einem Polizisten ins Gesicht spuckt, der könnte nach meinem Verständnis durchaus auch wegen (versuchter oder vollendeter) Körperverletzung bestraft werden. Meiner Erinnerung nach verwies ich damals schon auf Analogien zum HIV-Virus.

    Ihre Forderung klang mir eben zu sehr nach Stammtisch für MENSCHEN-BILDER.

  6. @Kuhn: Begriffliches & Gesetzliches

    Danke erst einmal für den begrifflichen Kommentar. Sie haben Recht; und doch denke ich, dass man im Artikel weiß, was ich meine. Beim nächsten Mal würde ich es anders formulieren.

    Es gibt übrigens nicht nur die GKV, sondern auch die PKV – und bei den privat Versicherten sind (allgemein, nicht immer) die Vermögensverhältnisse anders.

    Die Beispiele, die Sie anführen, sind für mich aber nicht so überzeugend. Nehmen wir das Rauchen:

    Dieses wurde jahrzehntelang mit Werbung unterstützt; Studien zur Gefährlichkeit wurden aktiv von der Tabaklobby unterdrückt; der Staat verdient an Steuern ordentlich mit (und diese sind in der jüngeren Vergangenheit erheblich gestiegen); es geht zudem um ein Suchtmittel, das, wie treue Leser dieses Blogs wissen, auch bestimmte psychosoziale Bedürfnisse befriedigt; zudem ist unser Gesundheitssystem auch zusammen mit dem Rauchen gewachsen, kann das also eher “auffangen”; die durchs Rauchen verursachten Krankheiten werden in den nächsten Jahrzehnten wohl abnehmen (weil weniger Menschen rauchen, jedenfalls in Westeuropa).

    Sie sehen: Rauchen ist vielmehr eine traditionelle und gesellschaftliche Angelegenheit als das Coronavirus.

    Und im Text erwähnte ich das Beispiel eines Lesers: Jemand fährt außerhalb der (als sicher) ausgewiesenen Piste Ski. Auch hier würde ich sagen, helft dem-/derjenigen bei einem Unfall. Aber warum nicht diese Person dann an den Rettungs- und Behandlungskosten beteiligen? Dann setzt auch eher ein Lerneffekt ein.

  7. @Schleim
    Selbstverständlich liegt eine Körperverletzung, im Fall von Ungeimpften eher fahrlässig, erst dann vor, wenn eine Infektion durch das Coronavirus stattgefunden hat. Zusätzlich hätte man die Einhaltung der Coronamaßnahmen zu berücksichtigen. Als Stammtischgeschwätz würde ich es nicht abtun. Die Folgen einer Infektion können dafür zu gravierend sein. Andernfalls hätten Sie diesen Blog wohl nicht geschrieben.

  8. Faktenbasierte, neutral formulierte und nachvollziehbare Erläuterungen des Sachverhalts sind die Basis für den Erfolg.

    Angesichts der Neuartigkeit einer solchen Pandemie ( für uns und bei uns ) sind gewisse handwerkliche Fehler im Nachhinein erkenn-, erklär- und bei etwas gutem Willen auch verzeihbar – wenn man den auf der anderen Seite den guten Willen sieht, Fehler nicht zweimal zu machen, sondern daraus zu lernen.

    In dieser Hinsicht mache ich hier und jetzt keinen Kommentar zur Politik.

    Die andere Seite sind die menschlichen Eigenschaften, wir wissen, dass selbstgewählte und bevorzugte Risiken immer als deutlich kleiner eingeschätzt werden als von außen “aufgezwungene” scheinbare Risiken, vor allem, wenn sie mit “du musst” und “du sollst” einherkommen.

    Die dritte Seite ist durch das Gefühl des benachteiligt werdens, des hin- und hergeschubst werdens, des abgehängt seins begründet, was in einer Reaktion “jetzt erst recht nicht” enden kann.

    Und die vierte Seite ist auch nicht von der Hand zu weisen, die des kognitiven Kurzschlusses, die jeden treffen kann, auch ( Beispiel! eines intellektuellen Zustands ) Professoren, das völlig Ausblenden eines Teils der Fakten und die Betrachtung anderer Fakten in ( unzulässig ) vergrößertem Maßstab.

    Die fünfte Seite: Das Leben in einer Gemeinschaft/Gesellschaft ist immer ein Kompromiss, ein Geben und Nehmen ( auch, wenn viele den Eindruck haben, selber immer geben zu müssen und wenig nehmen zu dürfen, im Gegensatz zu denen, die es scheinbar genau entgegengesetzt machen ). Die Gesellschaft sorgt für den Einzelnen, besonders sorgt sie dafür, dass der Einzelne für sich selber sorgen kann ( letzteres kommt in den Betrachtungen meistens zu kurz ), aber die Gesellschaft muss auch für sich selber sorgen, sie muss den Einzelnen / die Gruppen schützen und sich vor dem Einzelnen / den Gruppen schützen, das ist immer eine Güterabwägung.

    Es ist ja nicht so, dass die Pandemie der Einzelfall ist, der zum ersten Mal das Verhältnis von Gesellschaft und Individuum neu zu denken Anlass gibt, der größte Teil der Gesetze dient diesem Zweck, die unterschiedlichsten Dinge werden geregelt.
    Da die Pandemie aber für uns eben eine neue Erfahrung ist, müssen wir uns das Regelwerk neu erarbeiten, neu diskutieren, auch unter Berücksichtigung anderer, ähnlich gelagerter Problemfälle ( hier: ungesunder “Sport”, ungesunde Nahrung zB ).
    Dabei ist “Geld” zwar kein hauptsächlicher Bewertungsgrund, aber die Umrechnung jeglicher Zustände in “Kosten” kann uns helfen, die Dinge zu priorisieren, Ranglisten zu erstellen. Wenn schon der Staat die Impfung kostenlos beistellt und “sich damit Kosten für Intensivstationen und Personal einspart” – und natürlich uns als Individuum damit höchstwahrscheinlich schwere Krankheit oder gar Tod, so sollte man angesichts der Faktenlage durchaus ein Preisschild an die Krankenhaus-Dienstleistung für Nicht-Impfwillige ( “Privatpatient” ) hängen, um die Zusammenhänge deutlich zu machen.

  9. @Reutlinger: Körperverletzung

    Nun gut, aus heutiger Sicht auf Ihren entsprechenden Kommentar vom 16. September ziehe ich den “Stammtisch” zurück. Entschuldigung.

    Bleiben die praktischen Probleme, die ich hier nicht wiederholen werde.

    Mit Blick auf die sozialen Auswirkungen Ihres Vorschlags bleibe ich aber bei meiner abwertenden Haltung. Diese Freiheit steht mir zu.

  10. “Es ist schlicht unternehmerische Logik, möglichen Schaden vom Unternehmen fernzuhalten.”

    Und genauso ist es schlicht gesunder Menschenverstand, mögliche Impfschäden von meinem Körper fernhalten.

  11. @Schleim
    Mir geht es nicht um Ihre Entschuldigung, da stehe ich drüber. Mir ist schleierhaft, welche negativen “sozialen Auswirkungen” mein Vorschlag haben sollte. Die sozialen Auswirkungen Ihres Vorschlags sehe ich viel drastischer. Die Kosten einer Behandlung können individuell verschieden und sehr hoch sein. Wie will man eine Kostenbeteiligung gerecht regeln? Wie geschieht die Ursachenzuordnung? Was ist mit der Kostenbeteiligung wenn der Patient zahlungsunfähig oder tot ist? Sollen Angehörige oder Verwandte dann zahlen müssen?

  12. @Müller
    Und was ist mit den möglichen Infektionsschäden? Welche der Schäden haben höhere Wahrscheinlichkeit? Sind nach millionen Impfungen Todesfälle durch die Impfung bekannt? Wieviele Todesfälle durch Covid19 stehen dagegen?

  13. @Müller: Geheimnis

    Ich verrate Ihnen ein Geheimnis: Leben beinhaltet Risiken und endet in 100% der bisher bekannten Fälle… mit dem Tod.

    Alles Gute!

  14. @Reutlinger: soziale Auswirkungen

    Wenn Ihnen die starke Polarisierung noch nicht aufgefallen ist, wenn man nur das Wort “Impfpflicht” o.Ä. erwähnt, dann kann ich Ihnen auch nicht helfen…

    …und mit Ihren “Gegenargumenten” sind wir dann doch auf Stammtischniveau angekommen. Das sind alles nur Pseudo-Ausflüchte. In der Praxis gibt es hier gar keine Probleme.

    (Tipp: Der Impfstatus lässt sich feststellen; eine COVID-Erkrankung auch; ebenso das Einkommen, zumindest prinzipiell, und die Kosten. Großes Geheimnis: Letzteres machen die Krankenhäuser sowieso, bloß geht die Rechnung an die Krankenversicherung bzw. den privat Versicherten, der sie dort deklariert. Und für den Umgang mit Zahlungsverpflichtungen, auch nach dem Ableben einer Person, gibt es allgemeine Regeln des BGB, die sowieso gelten.)

  15. @Schleim
    Ihre Argumentation ist unausgegoren und naiv. Die Sache, also die Festlegung einer solidarischen Kostenbeteiligung, ist keineswegs so klar und einfach. Auf das Stammtischniveau Ihrerseits lasse ich mich nicht ein.

  16. @anton reutlinger

    “Sind nach millionen Impfungen Todesfälle durch die Impfung bekannt?”

    Ja.

    “Wieviele Todesfälle durch Covid19 stehen dagegen?”

    Wieviele durch Covid verstorben sind, kann wohl niemand genau sagen da ja auch die Fälle dazugerechnet werden, die “mit Corona” verstorben sind. Viele können es aber nicht gewesen sein, da es letztes Jahr sogar eine Untersterblichkeit in Deutschland gegeben hat. Deshalb sind die meisten vermutlich “mit Corona” gestorben.

  17. @Müller
    Das ist Ihr persönliches Risiko, ohne Zweifel. Die Frage ist aber, ob Sie es verantworten können, viele Andere dadurch mit hoher Wahrscheinlichkeit zu infizieren und massiv zu schädigen, allen voran Ihre Familie.

    Warum halten Sie sich an die Verkehrsregeln und viele andere Vorsichtsmaßnahmen? Ihre Haltung ist aus meiner Sicht heuchlerisch, selektiv und kurzsichtig; und natürlich auch unsolidarisch oder unsozial.

  18. @Peter Müller
    Ist man pro Leben,ist es weder vernünftig,noch hat es was mit gesundem Menschenverstand zu tun.
    Eher mit opferndem Heroismus,um seine Meinung zu demonstrieren. Das ist unter dem Gesichtspunkt eines pro Leben ziemlich dämlich.

    Was mich seit Dekaden fasziniert ist,dass wir ständig nach durchgehenden Argumentationen suchen,aber nicht sehen wollen, dass wir damit immer mit Antonymen handeln.
    Warum gibt es Antonyme und warum hat Hegel daraus These und Antithese gemacht?
    So ist es auch in dieser Diskussion mit Solidarität=Altruismus=Kooperation vs Egoismus=Konkurrenz=Wettbewerb um Leben.
    Wenn wir um diesen Widerspruch wissen,ihn erkennen,es Erkenntnis ist,warum ist es dann nicht möglich ihn aufzulösen…?

  19. @Reutlinger: Körperverletzung

    Ihnen ist es in eineinhalb Monaten nicht gelungen, auch nur ein Argument gegen die gewichtigen theoretischen wie praktischen Einwände gegen Ihren Vorschlag vorzubringen.

    Warum beglücken Sie nicht den Bundestagsabgeordneten Ihres Vertrauens mit Ihrer genialen Idee? Das würde hier jedenfalls Zeit sparen. Viel Erfolg!

  20. @Müller: individuelles Risiko

    Das können, ja müssen Sie dann tragen – als Mensch in dieser Gesellschaft.

    Nur komisch, dass Sie dann wahrscheinlich, falls Sie schwer an COVID erkranken sollten, Ihren Standpunkt ändern werden: Dann heißt es nicht mehr “individuelles Risiko”, sondern “Gesellschaft rette mich!”

    (Natürlich gönne ich allen meinen Leserinnen ein möglichst langes und gesundes Leben.)

  21. @anton reutlinger

    “Warum halten Sie sich an die Verkehrsregeln und viele andere Vorsichtsmaßnahmen?”

    Weil die meisten davon sinnvoll sind. Als Fußgänger warte ich allerdings nachts nicht bei rot, wenn weit und breit kein Auto zu sehen ist.

    “Ihre Haltung ist aus meiner Sicht heuchlerisch, selektiv und kurzsichtig; und natürlich auch unsolidarisch oder unsozial”

    Sie haben sich eben Gehorsamkeit als “Solidarität” verkaufen lassen. Ich sehe nichts solidarisches daran zu gehorchen. Ich erkenne in Ihrer Haltung die typisch deutsche Untertanenmentalität.

    https://www.bedeutungonline.de/was-ist-untertanenmentalitaet-obrigkeitsgehorsam-obrigkeitshoerigkeit-bedeutung-definition/

  22. @Stephan Schleim: 01.11. – 14:52 Uhr

    Ja – aber ich denke, wer sich jetzt noch nicht hat impfen lassen, der ist Fakten eher nicht zugänglich.

    Stimmt.
    Das ist definitiv eine allgemeingültige Aussage.
    All die älteren und geschwächten Menschen in den ärmeren Regionen der Welt scheinen offenbar den Ernst der Lage nicht zu erkennen.
    Sonst würden sie sich ja einfach impfen lassen.

    …achso, die haben gar nicht genügend Impfstoff?!
    Warum denn nicht? Vielleicht, weil wir hierzulande immer noch versuchen, auch Menschen mit vergleichsweise niedrigem Risiko indirekt zur Impfung zu zwingen, statt mehr Impfstoff zu spenden? Damit wir hier unsere vergleichsweise harmlosen Probleme (ich habe die Kernaussage des Artikels verstanden; aber wenn wir unsere deutschen Probleme mit denen ärmerer Länder vergleichen, ist diese Formulierung meiner Meinung nach angebracht) minimieren können?
    Entschuldige den Zynismus, aber wie ist das denn bitte mit unserer angestrebten Solidarität vereinbar?
    Und wenn ich dann auch noch sowas lese, wird mir wirklich übel. Wo leben wir bitte? Sind das nicht genauso unsere Mitmenschen, die wir dort in anderen Regionen der Welt reihenweise sterben und viel stärker unter den Folgen der Pandemie leiden lassen???
    Ich bin jung, gesund, stecke mit meiner Lebensweise wahrscheinlich niemanden an, und möchte daher, dass meine Impfdosen an Menschen in armen Ländern gespendet werden, die ein hohes Risiko haben. Bitte, falls irgendjemand bei Entscheidungsträgern diese Option ins Spiel bringen kann, tu es.
    Das wäre eine Form von Solidarität, mit der auch ich als vermeintlich für Fakten nicht zugänglicher Mensch etwas anfangen könnte.
    Bevor wir jetzt beginnen, die gesamte Bevölkerung durchzuboostern, sollten bitte(!) endlich mal all die Menschen Impfstoff bekommen, die in der Priorisierung eigentlich noch vor vielen von uns liegen.
    Ich würde dafür sogar noch einen weiteren Winter mit Einschränkungen in Kauf nehmen.

  23. @Stephan Schleim

    “Nur komisch, dass Sie dann wahrscheinlich, falls Sie schwer an COVID erkranken sollten, Ihren Standpunkt ändern werden: Dann heißt es nicht mehr “individuelles Risiko”, sondern “Gesellschaft rette mich!”

    Nein dann heisst es, dass ich nach jahrzentlangem Einzahlen in die Krankenkasse auch mal eine etwas teurere Leistung in Anspruch nehme. Bisher war die Einzahl-/Inanspruchname-Quote bei mir sehr zu meinen Ungunsten, so das ich da keine moralischen Bedenken habe.

  24. @Müller, das RKI differenziert
    “an” Corona sind 83% verstorben, “mit” waren es 17% und einer schweren Vorerkrankung,
    die hätten vielleicht ohne Corona auch noch leben können, die Ärzte können Diagnose

  25. @Karl Maier:

    Faktenbasierte, neutral formulierte und nachvollziehbare Erläuterungen des Sachverhalts sind die Basis für den Erfolg.

    Vielen Dank, Sie scheinen sich meinen Appell aus unserer Diskussion zu einem anderen Artikel zu Herzen genommen zu haben.
    Und genau deshalb habe ich mir Ihren Beitrag hier mit Interesse durchgelesen, dem ein oder anderen Punkt auch zugestimmt, und habe Ihren Ausführungen auch Nichts hinzuzufügen (und nehme mir diese auch zu Herzen!).
    Danke für diesen sinnvollen Schritt in die meiner Meinung nach richtige Richtung.

  26. @ Peter Müller:

    Sie sollten sich aktiv anstecken, damit sich die Sache mit der Krankenkasse auch garantiert lohnt. Vielleicht kriegen Sie sogar eine Chefarzt-Behandlung auf Intensiv und holen netto noch richtig was raus.

  27. Ungeimpfte zahlen zu lassen für Kosten aufgrund ihrer Covid-Erkrankung würde gut zum Verursacherprinzip passen, das beispielsweise im Umweltrecht immer mehr an Bedeutung gewinnt.
    Doch für das Gesundheitswesen ist das undenkbar, denn es hat dort überhaupt keine Tradition. Für keine einzige Erkrankung wurde bis jetzt dem Verursacher die Kosten aufgebürdet, nur weil er sich die Krankheit teilweise durch eigenes Verschulden zugezogen hat.

    In Bezug auf ansteckende Krankheiten gibt es andere Traditionen und diese verstärkt in Anspruch zu nehmen, wäre naheliegender. Klassisch ist der Versuch, Ansteckungen zu verhindern beispielsweise durch Isolationsmassnahmen oder durch Zutrittsbeschränkungen.
    Ungeimpfte und tagesaktuell nicht getestete Pflegerinnen und Pflegern etwa sollten nicht arbeiten dürfen.
    Nun darüber wird längst diskutiert oder es wird stellenweise bereits praktiziert. Das gleiche Prinzip könnte man aber noch breiter anwenden.

    Eine Kostenbeteiligung Ungeimpfter lässt sich jedenfalls auf die schnelle nicht durchsetzen. Das wäre Stoff für eine politisch/massnahmenrechtliche Neuorientierung und würde wohl eine breite gesellschaftliche Diskussion nötig machen, die einige Monate bis Jahre in Anspruch nähme und damit nichts zur Bewältigung der aktuellen Lage beitrüge.

  28. Das staatlich beglaubigte Narrativ ist doch heute, dass Geimpfte ebenso das Virus weitergeben können wie Ungeimpfte, und dass die Impfung lediglich vor einem schweren Verlauf schützt. Der Vorwurf an Ungeimpfte, sie würden andere in Gefahr bringen, erhoben von Geimpften, die sich auf 2G-Parties anstecken, ist daher in der Rubrik Orwellian doublethink einzuordnen.

    Woher kommt also der Hass vieler Ungeimpfter auf Geimpfte? Eine mögliche Erklärung könnte sein, dass Geimpfte mit ihrem experimentellen Impfstoff ein gewisses Risiko eingegangen sind und nun argwöhnisch auf diejenigen blicken, die Geduld bewiesen haben. Man hat selbst ein Opfer gebracht und versteht nicht, dass diejenigen, die dieses Opfer nicht gebracht haben, die gleichen Rechte haben sollten.

    Man kennt diese Deutung von Heimkehrern aus dem Vietnam-Krieg, die mit Verachtung auf Pazifisten und Kriegsdienstverweigerer schauten: “Ich habe mein Bein gegen den Kommunismus verloren und dieser pazifistische Hippie-Penner will mir nun im Unternehmen Befehle erteilen?” Das ist psychologisch nachvollziehbar, handelt sich aber um eine non sequitur: Der Hippie hat den tapferen Soldaten nämlich nicht in den Krieg geschickt und der Ungeimpfte hat den Geimpften auch nicht zu seiner Impfung gezwungen.

    @ Peter Müller,

    Ich sehe das wie Sie. Leider werden die Orte, in die man auswandern könnte, knapp. Auch Amerika ist nicht mehr frei.

  29. @Stephan Schleim
    Die Argumentation steht eben auf wackligen Füßen, nachdem immer wieder Meldungen und Studien zu lesen sind, in denen behauptet wird, dass die Virenlast zwischen geimpft/ungeimpft ähnlich ist. Wie dem auch sei, einen gewissen Schutz vor Übertragung bietet die Impfung hoffentlich, ob das aber am Ende des Tages wirklich so viel Einfluss hat, sei dahin gestellt.

    Welches Verhalten ist hier solidarisch? Sich nicht nur für das eigene Wohl, sondern auch im Interesse des Pflegepersonals und fürs Leben von anderen Menschen zwei-, vielleicht dreimal piksen zu lassen

    Ich bewundere alle Menschen, die sich aus reiner Solidarität zum Mitmenschen impfen, aber mal ehrlich, die meisten machen es aus Selbstschutz oder um sich der Testerei zu entziehen…

    Eigentlich bin ich betrübt darüber, allen Menschen, die sich nicht impfen lassen, Unsolidarität zu unterstellen. Es gibt Menschen, denen ist die eigene Gesundheit wichtig, die kümmern sich um gute Ernährung etc. Auch die tragen somit ihren Teil dazu bei, das Gesundheitssystem nicht zu überlasten und gar nicht erst krank zu werden. Die “Impfeuphoriker” sehen die Impfung als einziges Mittel, schwere Krankheitsverläufe zu vermeiden und doch gibt und gab es immer wieder Meldungen und Studien, dass ein niedriger Vit D3 spiegel mit schweren Krankheitsverläufen korreliert (gerne googlen). Was, wenn der Zusammenhang stimmt und einige der schweren Verläufe bereits durch entsprechende Supplementierung gar nicht erst auftreten würden???

    chris

  30. @Müller
    Solidarität hat absolut nichts mit Gehorsam zu tun. Ihre Behauptung ist eine Diffamierung, wie sie heute bei Systemgegnern üblich ist. Niemand lässt sich aus purer Solidarität impfen, sondern zum eigenen Schutz, aber es ist dadurch auch ein Akt der Solidarität. Die Ungeimpften belasten unnötig das Gesundheitssystem und das Pflegepersonal, abgesehen von der Infektionsgefahr für die Mitmenschen. Gehen sie in ein Krankenhaus und informieren Sie sich. Die Trotzhaltung gegen die Impfung bzw. gegen das bürgerliche System ist genauso irrational wie der blinde Gehorsam.

  31. @Holzherr
    Das Verursacherprinzip, bzw. die Zuordnung einer Ursache zu einer Krankheit, ist gerade das Problem. Bei einem Unfall ist es relativ einfach, aber bei schweren Krankheiten ist es in aller Regel nicht eindeutig. Oftmals sind mehrere Ursachen beteiligt und nur der Auslöser wird sichtbar. Dazu kommt, dass Krankheitsverläufe und Therapieerfolge individuell sehr verschieden sein können, bei gleicher Krankheitsursache und -symptomatik.

  32. @ anton reutlinger,

    Die Trotzhaltung gegen die Impfung bzw. gegen das bürgerliche System ist genauso irrational wie der blinde Gehorsam.

    Das ist der klassische Taschenspielertrick des Platon. Sie suggerieren hier eine Dichotomie zwischen Ungeimpften und Bürgerlichen. Ergo, Geimpfte sind bürgerliche Liberale, Ungeimpfte sind Antiliberale. Damit werden die Werte auf beindruckende Weise auf den Kopf gestellt. Was könnte denn liberaler sein, also über seinen eigenen Körper zu verfügen?

  33. @anton reutlingen

    Sie unterstellen mir also das ich “unsolidarisch” sei, sagen aber gleichzeitig, dass sich sowieso niemand aus Solidarität impfen lässt?

    “..gegen das bürgerliche System..”

    Das zeigt nur, wie sehr Sie in Ihrer Untertanenmentalität gefangen sind. Nicht nur das Sie selbst Obrigkeiten nicht hinterfragen; Sie setzen dieses Hinterfragen auch noch mit einer “Gegenschaft zum System” gleich.

  34. @Spike-Protein
    Nein, es war nicht meine Absicht, Impfverweigerung und bürgerliches System als Dichotomie zu bezeichnen, sondern Letzteres als Rahmen zur persönlichen Haltung, in diesem Fall zur Impfung oder Impfverweigerung.

    Übrigens: Wahre Freiheit ist immer auch mit Konsequenzen und mit Verantwortung verbunden.

  35. Peter Müller
    01.11.2021, 18:29 Uhr
    Als Fußgänger warte ich allerdings nachts nicht bei rot, wenn weit und breit kein Auto zu sehen ist.

    Das können Sie auch tun, nicht nur, weil nachts kaum Polizei unterwegs ist, nicht nur, weil nachts meistens wenig Verkehr ist, sondern weil meistens die Fußgängerüberwege nachts beleuchtet und Sie damit zu sehen sind und kein Autofahrer mutwillig einen Menschen überfahren würde, auch wenn der bei Rot über die Starße geht.
    Dazu haben die Fahrzeuge auch fast immer die beleuchtung eingeschaltet und Sie können ein nahendes Fahrzeug sehen und notfalls zur Seite springen.

    Und nun stellen Sie sich vor, dass in einer zappendusteren Nacht nur das Rot der Fußgängerampel schwach leuchtet und alle von den Fahrzteugen schwarz lackiert und mit hoher Geschwindigkeit ohne Licht daherkommen – gehen Sie dann noch bei Rot über die Straße oder warten Sie nicht doch auf Grün, weil dann vereinbarungsgemäß die Fahrzeuge brav anhalten?

    So ähnlich ist das mit dem Virus: Sie sehen es nicht, sie hören es nicht, es kann von überall kommen. Nur eine Maske schützt Sie direkt und eine Impfung vor den schweren Folgen eines “Unfalls” …

  36. Peter Müller
    01.11.2021, 18:40 Uhr
    … dass ich nach jahrzentlangem Einzahlen in die Krankenkasse auch mal eine etwas teurere Leistung in Anspruch nehme. Bisher war die Einzahl-/Inanspruchname-Quote bei mir sehr zu meinen Ungunsten, so dass ich da keine moralischen Bedenken habe.

    Mir scheint, Sie haben das Prinzip “Versicherung auf Gegenseitigkeit” nicht ganz verstanden.
    Im ersten Schritt geht es darum, dass alle je nach “Vermögen” in eine gemeinsame Kasse einzahlen, das gilt für die Krankenkasse wie auch die Rentenversicherung und in etwa für die kapitalistisch organisierte Hausratversicherung und die Kfz-Haftpflichtversicherung, letztere zwar gesetzlich Pflicht, aber privatwirtschaftlich-kapitalistisch organisiert.
    Aus dieser jerweiligen Kasse werden die anfallenden “Schäden” beglichen.
    Bei der Kfz-Haftpflichtversicherung wird sogar dem von Ihnen geäußerten Verhalten ( “Einzahl-/Inanspruchname-Quote bei mir sehr zu meinen Ungunsten” ) auch mit der Bonus-/Malus-Regelung gegen provozierte Auszahlungswünsche vorgebeugt.
    Bei der “Krankenkassenabrechnung” handelt es sich bei Ihnen noch um eine Momentaufnahme, es gibt noch keine Schlussabrechnung, die kommt erst mit Ihrem Ableben und erst dann wird klar, ob Sie mehr eingezahlt oder mehr abgehoben haben werden.
    Und im Grunde ist es doch paradox, wir versichern uns zwar gegen Schäden, hoffen aber doch wohl meistens ( bei der Rente als “Versicherung” ist es anders 😉 ), dass wir die Schadenersatzleistung wohl nie in Anspruch nehmen werden müssen. Bei der Krankenversicherung wäre es den meisten bei logischer Überlegung doch wohl am liebsten, wenn sie nur einzahlen und nie abheben müssten ( = nie krank werden ).

  37. Was für eine wirre und äusserst unwissenschaftliche Diskussion/Artikel. Die Fakten:

    Schweden/Flordia haben seit zig Monaten weder Impflicht noch Lockdown und geringere Inzidenden als New York, Israel…

    Impftote gibt es, einfach mal googeln: https://www.berliner-zeitung.de/news/frau-stirbt-mit-32-an-corona-impfung-das-sagt-ihre-mutter-li.188936

    Man impft nicht in eine Pandemie hinein. v.a. wenn es nur eine kleine Risikogruppe gibt impft man nicht die ganze Bevölkerung, weil es sonst einen Mutationsdruck gibt für das Virus. Schweden hat genau richtig gehandelt die Jungen sich natürlich immunisieren zu lassen, die alten leider etwas zu spät geschützt. Dennoch hätten diese im Schnitt nicht mehr mehr viele Jahre gelebt, Altenheimbewohner versterben im Schnitt binnen 12 Monaten.

    Lieber Herr Schleim, ihr Blog bleibt für mich lesbar zu neurophilsophischen Themen und vielleicht sollten sie diese Perspektive mal anwenden auf die Pandemie statt Spaltung in Geimpfte und Unsolidarische mit solchen sinnfreien weil faktisch völlig unplausiblen Diskussionen vom Zaun zu brechen. Nichts an dieser Pandemie ist plausibel und entspricht Größenordnungen die dieser Massnahmen bedürften. Sie sollten sich fragen wie eine Gesellschaft in völlige Hysterie, Konformismus sich treiben lassen kann, während wir bei Katastrophen ala Fukushima nach wenigen Wochen das Ganze vergessen hatten. Evtl., meine Hypothese, ist die technologisch determinierte Gesellschaft dabei durch die Digitalisierung mental völlig dement zu werden und nur noch im Präsens aber nicht mehr vorrausschauend zu agieren und alle ihre Errungenschaften der letzten Dekaden in 18 Monaten in die Tonne zu kloppen, wg. eines Virus das in 5 Jahren wieder aus dem Labor entweichen kann? Denn sonst hätte der Mob die Veranstalter dieses medialen Theaters längst aus dem Parlament gejagt.

    Zudem funktioniert die Impfung nachweislich nicht, damit erübrigt sich hier ihre ganze Diskussion. Alle Impfhochburgen sind Inzidenzhochburgen, es gibt Regionen mit 99% Durchimpfung und das Virus ist immer noch da. Es ist auch nciht schwer zu verstehen wie man auf eine Impfwirksamkeit auf 95% gekommen ist, wenn das Virus bei den meisten sogenannten Infizierten überhaupt nicht bemerkt wird bzw. ein positiver PCR-Test keine Infektion/Verbreitung feststellt sondern nur das Tragen des Virus. Die Impfung schützt nciht vor Erkrankung, wenn die Viruslast geimpft/ungeimpft ähnlich hoch ist, weil die Impfung nur die Viruslast regulieren kann und kein Medikament für Symptombehandlung ist.

    Das Niveau ist ja fast noch unterirdischer als bei Maischberger, die Klabauterbauch in einer Sendung vorzeigt, dass max. 50% seiner Warnungen sich bewahrheiten und ihn dann wieder einlädt aber ihre Faktenchecker Prof. Ioannadis als umstritten titulieren. Was hat das noch mit Wissenschaft zu tun? Warum werben auf den Scilogs auf einmal mehrere Medizinstudentinnen als Autoren für die Impfung, finden sich keine richtigen Autoren mehr ähnlich wie für den Beraterstab der Regierung der aus <45 jr. ProfessorInnen besteht ohne jegliche Krisenerfahrung aber Ethikratvorsitzende sind? Der erfolgreichste praktizierende Physiker wurde als Verschwörungstheoretiker gebrandmarkt, mittlerweile steht so gut wie fest, selbst Kekule behauptet es, dass das Virus aus dem Labor kam.

    Was glauben Sie liebe Kommentatoren eigentlich was Sie mit ihrem Konformismus gegen "Systemgegner" hier gewinnen/retten mittel- oder langfristig? Ihre eigene Stelle im öfftl. Dienst? Wie ist dieses Land zu seinem Reichtum gekommen, den Politikclowns, Nichtskönner wie Mai-Thi und Böhmermann, ÖRR und ÖD jetzt leersaugen? Mit wissenschaftlichen Konformimus und vorauseilendem Gehorsam? Armes Abendland.

    Wie rechnen Sie als Neurophilosoph eigentlich die wenigen Impftoten gegen vermeintilch vielen Coronatoten auf? In Lebensjahren? 3.000 Verkehrstote Durchschnittsalter 50 vs 90.000 Coronatote Durchschnittsalter 84 bei Lebenserwartung 80. Ist eine kurzer Dreisatz. Multiplizieren kann jeder selber.

    Wie kommt es, dass die USA, die technologisch führende Nation, die meisten Covid-Toten hat UND das Land ist das den dollen Impfstoff mitentwickelt hat. Weil dort die meisten Fettleibigen leben mit schlechten Immunsystem gegen das auch ein Impfzaubertrank nix mehr anrichten kann. Vielleicht hätten sie die Förderung der gain-of-function Forschung einfach sein lassen sollen, aber wie hätten sie dann den Rest Welt mit der Pandemie wieder neu verschulden sollen damit ihre Börsen und Unternehmen Höchstkurse feiern?

    Vielleicht hatte Ted Kaczynski Recht, die Technologie ist der Untergang der Menscheit, dummerweise sah er nicht ein, dass seine Taten völlig nutzlos waren, denn die Neugierde zum technologischen Fortschritt macht die Spezies Mensch aus, lässt sich nicht bekämpfen. Eine wirkliche Transzendenz über den Homo Sapiens bzw. Theatralis, wird des nur geben, wenn die Menschheit vor der kommenden AI-Singularität die Herrschaft über die Technologie errungen hat und den Fortschritt reguliert, sosnt ist das ihr Untergang, ob zivilisatorisch oder ökologisch. Und Sie diskutieren hier allen Ernstes über eine Impfpflicht für die ganze Welt, Impfpässe, völligen Konformismus damit alles beim alten bleibt. Der kommende imperialistische Kultur- und Rohstoffkrieg zwischen dem Westen und China wird Sie bald zu viel schwerwiegenderen und langfristigen moralischen und ethischen Fragestellungen zwingen.

  38. Ich möchte daran erinnern, dass wir in Deutschland das Grundgesetz haben!

    Die Einschränkung von Persönlichkeitsrechten war gesetzlich in Ordnung, solange es keinen Impfstoff gab. Bis Ende September konnten sich aber alle Menschen ab 12 Jahren impfen lassen.
    Ob man sich impfen läst oder nicht, bleibt nun dem Einzelnen überlassen.

    Aus diesem Grund/Grundrecht sollte man dazu übergehen, bisher ungeimpfte Leute mit Vernunft und Argumenten vom Impfen zu überzeugen – statt über Strafmaßnahmen nachzudenken.

    Leider ist es so, dass Politik, Journalismus und Wissenschaftskommunikation beim Thema ´Corona´ bisher keine sehr gute Leistung ablieferten. Ich möchte dazu nur an die Diskussionen zu AstraZeneca/Hirnvenenthrombose erinnern: So wie dieses Thema öffentlich behandelt wurde, muss man sich nicht wundern, dass danach viele Leute Angst vor dem Impfen bekommen haben.

  39. @ Michael Kuhn,

    erst einmal volle Zustimmung!

    Es ist auch nicht schwer zu verstehen wie man auf eine Impfwirksamkeit von 95% gekommen ist, wenn das Virus bei den meisten sogenannten Infizierten überhaupt nicht bemerkt wird …

    Der Schwindel mit den 95% kommt ja aus der urspr. Studie des BioNTech Impfstoffs und basiert auf einem simplen statistischen Trick.

    https://www.fda.gov/media/144245/download

    Man hatte in der Geimpften-Gruppe 8 “Corona-Fälle”, in der Ungeimpften-Gruppe 162. Wie wir wissen, ist die von SARS-COV2 behauptete hervorgerufene Symptomatik unspezifisch. Die Symptome (fever, cough, shortness of breath, chills, muscle pain, loss of taste or smell, sore throat, diarrhea, vomiting, fatigue, headache, nasal congestion or runny noses, nausea) sind alles klassische Symptome respiratorischer Erkrankungen, die ebenso von den 20 anderen Erregern hervorgerufen werden, die ständig in Umlauf sind: Rhenoviren, Adenoviren, Influenzaviren, andere Coronaviren etc.

    Auf der Seite 42 im FDA-Dokument findet man dann entscheidenden Satz:

    “Among 3410 total cases of suspected but unconfirmed COVID-19 in the overall study population, 1594 occurred in the vaccine group vs. 1816 in the placebo group.”

    Geimpfte waren insgesamt gesehen also fast so häufig krank wie Ungeimpfte. Sie hatten eben nur 95% weniger positive PCR-Tests. Wie Sie schon sagten, gute Wissenschaft würde sich auf diese Tatsache stürzen. Aber die Wissenschaft hat 2020 Goodbye gesagt.

    Das größte Verbrechen an dieser Impfkampagne dürfte wohl sein, dass naive Senioren seit einem Jahr denken, sie könnten allgemein zu 95% weniger krank werden als Ungeimpfte.

  40. @Schleim, Problemchen, daß hier die Antwortfunktion abgeschaltet wurde.
    Unwissen, Fakenews und pure Lügen von MS-P und M.K. kan man nicht ganz untendran richtigstellen.
    Da muß sofort für den Nachleser der Warnhinweis direkt dran, ansonsten schon TP-Niveau erreicht.

  41. Ungeimpfte Menschen moralisch unter Druck zusetzen, indem man von ihnen solidarisches Verhalten einfordert – ist der falsche Weg, um die Impfbereitschaft zu steigern.

    Vielmehr sollte man gezielt den egoistischen Eigennutzen hervorheben, den man hat, wenn man sich impfen lässt. Argumente gibt es genug! Wenn Menschen verstehen, dass und wie sie von Impfungen direkt profitieren, sind sie eher geneigt sich impfen zu lassen.

    Leider ist es so, dass viele Werbemaßnahmen für das Impfen nur sinnlos verschwendetes Geld bedeuten. z.B. hat nur ein kleiner Teil der Bevölkerung eine Tageszeitung abonniert. Wenn man dort für viel Geld eine Werbeanzeige für das Impfen schaltet – erreicht man damit nur Leute, die sowieso schon gut informiert sind. Werbeeffekt/Wirkung ist gleich Null.
    Viel sinnvoller wäre es, Werbeanzeigen in solchen Werbezeitungen zu schalten, die wöchentlich kostenlos an alle Haushalte verteilt werden. Damit erreicht man auch Personengruppen, die weniger gut informiert sind. D.h. hiermit kann man etwas bewirken.

  42. @Senf: Abschalten der sogenannten Antwortfunktion ermöglicht überhaupt erst Diskussionen mit Dutzenden Kommentaren. Ansonsten ist der Überblick einfach nicht mehr zu behalten.

    Und, ach ja, der Ruf nach Moderation: Leserinnen und Leser können sich schon ihre eigene Meinung bilden. Was ist das für ein Menschenbild? Man muss nicht immer gleich nach der “harten Hand” um Hilfe schreien.

    P.S. Es sollte zudem jedem hier klar sein, dass ein Diskussionsteilnehmer nur seine eigene Meinung vertritt und nicht etwa die des Verlags oder des Autors.

  43. @Chris: Viren und Solidarität

    Also ich las gerade noch, dass die Viruslast durch die Impfung um etwa 50% reduziert werde…

    …zudem wird wohl auch das Zeitfenster verkürzt: Ist doch logisch, dass man weniger (bzw. weniger lang) ansteckend ist, wenn das Virus vom Immunsystem stärker bekämpft wird.

    Es gibt halt nicht so leicht eine 100%-Lösung, die wirklich alle vollständig zufriedenstellt.

    Und die Unsolidarität besteht nach meinem Argument nicht darin, sich nicht impfen zu lassen, sondern in einer außergewöhnlichen Krisensituation die Kosten einer Erkrankung der Allgemeinheit aufzubürden, wenn man diese mit einfachen und frei verfügbaren Mitteln wahrscheinlich hätte vermeiden können.

  44. @Stephan Schleim

    “außergewöhnlichen Krisensituation”

    Diese Krisensituation gibt es eigentlich nur in den Medien. Es handelt sich eben nicht um eine tödliche Seuche sondern um eine grippeähnliche Krankheit. Das Gesundheitssystem war zu keinem Zeitpunkt überlastet und faktisch hatten wir letztes Jahr sogar eine Untersterblichkeit.

  45. @Spikes-Protein
    Ihre Behauptungen sind falsch, irreführend bis betrügerisch. Das von Ihnen erwähnte Dokument der FDA gibt nicht her, was Sie behaupten. Offenbar haben Sie gar nicht verstanden, worum es dabei geht. Wahrscheinlich haben Sie nur irgendwo blind abgeschrieben. Bei dem Zitat, das Sie anführten, geht es nicht um die Wirkung des Impfstoffs, sondern um die Sicherheit der Impfung durch Gegenreaktionen!

    Die ideologisch verbohrte Argumentation auf der Grundlage von Unverständnis, Lügen und Verdrehungen ist typisch für Ihresgleichen.

  46. @Müller: Corona-Situation

    Hier im Artikel verwies ich gerade auf acht Professorinnen und Professoren, jeweils Leiter einer Intensivstation einer Universitätsklinik, die Alarm schlagen. Denen glaube ich jetzt erst einmal. Es gab vorher schon ähnliche Aussagen von anderen Medizinern.

    Aber bei der Beantwortung der Frage, wann ein Gesundheitssystem überlastet ist, gibt es einen gewissen Interpretationsspielraum. Wenn Wissenschaftler und Mediziner jetzt nachweisen, dass wegen der Coronapandemie jede siebte potenziell lebensrettende Krebs-OP verschoben werden musste, dann nenne ich das “Überlastung”. (Vergessen Sie nicht: Sie könnten auch einmal auf so eine OP angewiesen sein.)

    Und dass es in Deutschland 2020 eine Untersterblichkeit gab, darüber habe ich ja gerade selbst geschrieben. Es lag halt daran, dass durch die Lockdowns andere Todesursachen reduziert wurden, während viele Menschen, die an/mit COVID-19 starben, auch ohne die Erkrankung wahrscheinlich im selben Jahr gestorben wären. Und dass Deutschland (noch) ein relativ gutes Gesundheitssystem hat. In Spanien, den USA oder Brasilien sah das schon anders aus.

  47. Warum nicht Menschen, die ohne medizinische Notwendigkeit auf die Impfung verzichten, an den Behandlungskosten beteiligen, falls sie später wegen COVID ins Krankenhaus müssen und sie sich das finanziell leisten können? [Artikeltext, Vorschlag von Dr. Stephan Schleim]

    Kann gemacht werden, aus diesseitiger liberaler Sicht spräche wenig dagegen.

    Allerdings widerspräche dies dem Solidaritätsgedanken [1], bspw. müssten idF unter anderem Motoradfahrer, Autofahrer vielleicht ebenso, Schwule, Drogen-“User”, Sportler, die bewusst Risiken gehen, sog. Risikosportarten sind gemeint, Raucher (hier sind Anwender von sogenannten Kulturdrogen, Tabak, Alkohol, Koffein, Teein et cetera gehören hinzu, vielleicht auch bald THC-Haltiges, dies in Abgrenzung zu sozusagen harten Drogen-“Usern”, mitgemeint), Übergewichtige, Personen, die nie körperlichen Sport betreiben, vielleicht auch Masochisten (kann dort ja mal bei derartiger Praxis etwas schief laufen) und so weiter – ähnlich angefragt werden, dem oben zitierten Vorschlag folgend.
    Nicht wahr?

    Dann wäre der Solidaritätsgedanke sozusagen gekillt.

    Mit freundlichen Grüßen
    Dr. Webbaer

    [1]
    ‘Solidarität’, ganz klar ist nicht, was gemeint ist, war mal ein politisch linkes Konzept, es ging darum dem politischen Gegner “solid”, mit der Menge wie ein Stein sozusagen entgegenzutreten, so dass Einzelne in dieser Menge nicht mehr erkannt werden können.
    Gut muss derartige ‘Solidarität’ nicht sein.

    PS:
    Ein angepasstes privates Versicherungswesen, auch Krankenversicherungen meinend, könnte deutlich besser leisten als ein wie bestendes “solidarisches”.

    (An sich will Dr. W einem gesundheitlichen Solidarsystem nicht gegenreden, Dr. W ist ja auch ordoliberal, also sozial sehr bemüht, will abär doch an dieser Stelle ein wenig den “Advocatus Diaboli” geben.)

  48. @Stephan Schleim

    “Es lag halt daran, dass durch die Lockdowns andere Todesursachen reduziert wurden”.

    Es ist schon erstaunlich, dass das mit weniger Verkehrstoten zusammenhängen soll. Statt im Auto saßen die Menschen ja nun zu Hause. Aber dort ist es eigentlich noch gefährlicher:

    “Etwa 2,8 Millionen Menschen verunfallen jedes Jahr im eigenen Zuhause. Rund 8.000 Menschen pro Jahr sterben sogar nach Haushaltsunfällen. Wie dramatisch viele das sind, zeigt der Vergleich zum Auto: Im allgemein als gefährlich anerkannten Straßenverkehr sterben nicht einmal halb so viele Menschen”

    https://www.hannoversche.de/wissenswert/zuhause-gefaehrlichster-ort-der-welt

  49. Dies hier scheint dem Schreiber dieser Zeilen ein wichtiger Punkt zu sein :

    “Es ist zu erwarten, dass die veränderte Versorgungssituation während der Pandemie, die durch Ergebnisse unserer Studie belegt ist, auch zukünftig Auswirkungen haben wird. Entsprechend kann man damit rechnen, dass durch Verschiebungen und verminderte Inanspruchnahme von Vorsorgeuntersuchungen während der Pandemie fortgeschrittene Krebserkrankungen auch in Deutschland verstärkt auftreten werden.” [Dr. Markus Löffler]

    Wie berichtet wird, werden auch notwendige Operationen verschoben, wegen “Corona”, und in einem Fall weiß der Schreiber dieser Zeilen, dass einem Sterbenden die letzte Ölung verweigert worden ist, denn einige Krankenhäuser befinden sich gerade auch wegen der angewiesenen gesonderten Behandlung von “Corona”, nicht durch “Corona”-Patienten selbst, die wohl nur eine bis zu fünfprozentige Auslastung bedeuten, in einer Notlage, auch die Kapazität i.p. Personal meinend.
    Es ist derart auch angestellt worden, Hilfskräfte meinend.

    “Corona” schadet also auch – womöglich primär indirekt – bei der generellen gesundheitlichen Versorgung.
    Bei Kindern und anderen Isolierten, deren natürliches Immunsystem so leidet, gäbe es ebenfalls etwas zu berichten.

    So richtig “fett” sozusagen wird die Argumentation des hiesigen werten Inhaltegebers – zu seinem im dankenswerterweise bereit gestellten WebLog-Eintrag getätigten Vorschlag hat sich Dr. W (der kein Mediziner ist) ein wenig weiter oben geäußert – hier nicht eingeschätzt.

    Gerade aus liberaler Sicht gilt es sich Gefahr (vs. Risiko, “Corona” ist kein Risiko, Luhmann, der WebLog-Artikel meint hier ein wenig anders) auch tolerant und wenn so gewollt, derart formuliert, auch solidarisch entgegenzustellen.

    Auch die Gefahr nicht übertreibend, Herr Dr. Stephan Schleim schrieb dankenswerterweise an anderer Stelle auch etwas zum Wesen der Gefahr “Corona”.
    “Corona” bedeutet keine schwere Epidemie, eine schwere Epidemie (“Endemie” auf internationaler Ebene) benötigt mehr sog. Übersterblichkeit.
    Angeblich sind die Definitonen der WHO vor einigen Jahren angepasst, geändert worden, so dass nur deshalb nun von einer Epidemie geredet werden darf; Dr. Webbaer lässt sich gerne diesbezüglich ergänzen.

    Mit freundlichen Grüßen
    Dr. Webbaer

  50. Hierzu kurz :

    Nur am Rande, terminologisch: Man sollte Langzeitfolgen und Spätfolgen auseinanderhalten. Wenn jemand infolge einer Impfung einen anhaltenden Impfschaden erleidet, ist das eine Langzeitfolge. [Dr. Joseph Kuhn [Psychologe, Gesundheitswissenschaftler ebenso]

    Ein wichtiger Punkt, Langzeitfolgen bedeuten, so ist die Terminologie (freundlicherweise) mittlerweile klar, dass sich kurzzeitig (sic) schädigende Folgen der Impfung ergeben haben, nachweislich geworden sind, die lange (!) wirken könnten, Spätfolgen meinen, dass sich erst spät Schadfolgen der hier gemeinten Impfung ergeben haben, also deutlich zeitversetzt.

    Medial, auch fachwissenschaftlich wird heutzutage nicht selten behauptet, dass es bei Impfungen kaum Spätfolgen gebe, auch nicht geben könne.
    Dies ist aber bei den neuartigen Impfungen nicht klar, denn es ist ja nicht abgewartet worden, kann so nicht abgewartet worden sein.

    Generell sind Spätfolgen auch schwierig nachzuweisen, wenn sich bspw. Demenz als Spätfolge (diese Idee ist von dem Bundesdeutschen Karl Lauterbach sozusagen geklaut) der Impfung ergibt, viele Jahre später und nur höhere Wahrscheinlichkeit i.p. ihres Auftretens meinend, wäre sie nachträglich kaum nachzuweisen, sofern sie nicht sozusagen überhand genommen hat.


    Dr. Webbaer hat noch vorsorglich in diesem Kommentariat den “Hass-Scan” vorgenommen, wer i.p. sog. Hass kommentiert, ist womöglich sicher jemand für die anderen, ein Fund nur :

    ‘Woher kommt also der Hass vieler Ungeimpfter auf Geimpfte?’
    (A: Es gibt keinen derartigen Hass.)

    Mit freundlichen Grüßen
    Dr. Webbaer

  51. @anton reutlinger

    @Spikes-Protein
    Ihre Behauptungen sind falsch, irreführend

    Aber, aber, @anton reutlinger. Falsch scheinen mir die Ausführungen von @Mutiertes Spike-Protein nicht zu sein, zumindest nicht alle vom 02.11.2021, 08:13 Uhr. Vielleicht sind sie irreführend für einen unverständigen Leser. Z.B:

    Geimpfte waren insgesamt gesehen also fast so häufig krank wie Ungeimpfte.

    Das ist ja auch wenig überraschend. Die Impfung schützt offensichtlich nicht vor den ’20 [anderen] Erregern, die ständig in Umlauf sind und die gleiche Symptomatik hervorrufen’.

    Man erwartet übrigens auch ähnlich viele Verkehrsunfälle pro Woche in der Placebo-Gruppe wie in der Geimpften-Gruppe.

    Unklar bleibt allerdings auch mir, warum @Mutiertes Spike-Protein meint, “gute Wissenschaft würde sich auf diese Tatsache stürzen”.

  52. @Müller: Schon ärgerlich, wie Sie nur die halbe Wahrheit wahrnehmen – die Hälfte, die Ihnen gefällt?

    Es wurde doch ausdrücklich erklärt, dass durch den Lockdown auch viel weniger Menschen an/mit der saisonalen Grippe gestorben sind. Die Verkehrstoten waren ein kleiner Faktor.

  53. @Webbär: Was für ein Kurzschluss. Hinter z.B. Substanzkonsum stehen u.A. a) eine Tabak- und Werbelobby, b) oft ist er Reaktion auf soziale Härten, c) der Staat verdient daran ordentlich mit, d) es handelt sich um keine außergewöhnliche Krisensituation, sondern die “Normalität”, mit der unser Gesundheitssystem gewachsen ist usw. usf.

    Ich werde es müde, immer wieder dieselben Banalitäten zu wiederholen; und dabei diskutiert Banalus hier noch nicht einmal mit.

  54. @Dr. Webbaer

    Woher kommt also der Hass vieler Ungeimpfter auf Geimpfte?

    Ja, über den Wortdreher bin ich auch schon gestolpert.

    Es gibt keinen derartigen Hass.

    Es gibt nichts, was es nicht gibt.

    Ich persönlich kenne einen solchen Fall. Geimpfte sind für ihn bösartig und gefährlich, weil die irgendwie mit Bill Gates unter einer Decke stecken und schreckliche Sachen verbreiten.

  55. @Joker
    Dass Corona-Geimpfte mehr Nebenwirkungen zeigen als Placebo-Geimpfte ist ebenso verständlich. Aus der Fülle der Zahlen zur Pandemie kann jeder das auswählen und deuten, was zu seinem Weltbild passt. Inwieweit es mit der Realität und mit Relevanz zu tun hat, ist eine andere Sache. Die Fehldeutungen sind bisweilen grotesk, man muss wohl Absicht vermuten.

  56. mal was grundsätzliches:

    https://www.sozialgesetzbuch-sgb.de/sgbv/1.html

    § 1 SGB V Solidarität und Eigenverantwortung
    Die Krankenversicherung als Solidargemeinschaft hat die Aufgabe, die Gesundheit der Versicherten zu erhalten, wiederherzustellen oder ihren Gesundheitszustand zu bessern. Das umfasst auch die Förderung der gesundheitlichen Eigenkompetenz und Eigenverantwortung der Versicherten. Die Versicherten sind für ihre Gesundheit mitverantwortlich; sie sollen durch eine gesundheitsbewußte Lebensführung, durch frühzeitige Beteiligung an gesundheitlichen Vorsorgemaßnahmen sowie durch aktive Mitwirkung an Krankenbehandlung und Rehabilitation dazu beitragen, den Eintritt von Krankheit und Behinderung zu vermeiden oder ihre Folgen zu überwinden. Die Krankenkassen haben den Versicherten dabei durch Aufklärung, Beratung und Leistungen zu helfen und unter Berücksichtigung von geschlechts-, alters- und behinderungsspezifischen Besonderheiten auf gesunde Lebensverhältnisse hinzuwirken.

    § 2 SGB V Leistungen
    (1) Die Krankenkassen stellen den Versicherten die im Dritten Kapitel genannten Leistungen unter Beachtung des Wirtschaftlichkeitsgebots (§ 12) zur Verfügung, soweit diese Leistungen nicht der Eigenverantwortung der Versicherten zugerechnet werden. Behandlungsmethoden, Arznei- und Heilmittel der besonderen Therapierichtungen sind nicht ausgeschlossen. Qualität und Wirksamkeit der Leistungen haben dem allgemein anerkannten Stand der medizinischen Erkenntnisse zu entsprechen und den medizinischen Fortschritt zu berücksichtigen.

    § 52 SGB V Leistungsbeschränkung bei Selbstverschulden
    (1) Haben sich Versicherte eine Krankheit vorsätzlich oder bei einem von ihnen begangenen Verbrechen oder vorsätzlichen Vergehen zugezogen, kann die Krankenkasse sie an den Kosten der Leistungen in angemessener Höhe beteiligen und das Krankengeld ganz oder teilweise für die Dauer dieser Krankheit versagen und zurückfordern.

    Bei aktuellem Stand der wissenschaftlichen medizinischen Erkenntnis, könnte man durch aus von bedingtem Vorsatz sprechen: billigend in Kauf nehmend.
    Soweit weg ist die Gesetzesgrundlage von der Diskussion nicht.
    Stellt sich die Frage, wie eben seit Monaten, was ist Erkenntnis, was Meinung und was Glaube und was bewusste Irreführung/Verdrehung (aus z.B. Systemgründen). Damit wären wir auch wieder bei den “Gegenargumenten”, die lediglich eine Diskussion am Laufen halten. Das könnte ewig so gehen und scheint auch Interesse zu sein.

  57. Also, für mich steht relativ sicher fest, das man sich auch mit Corona anstecken kann (oder die Symptome dramatisieren kann), wenn man nach allen Regeln der Infektiologie isoliert ist. Etwa, wenn man im Internet seine Meinung äußert (sich als Identität bemerkbar macht) und das dann gewisse Menschen sehen und sich daran stoßen/stören.

    Die “Tröpfchen-Ansteckung” ist dabei nicht notwendig und das zeigt auf, was es eigendlich ist. Eine über reine Information und Identitäten-Konfrontation ausgelösste “Krankheit” und Symptomatik, die nur durch Assimilierung oder assimiliernder konfrontation von Identitäten ausgelösst wird.

    Das betrifft jetzt zwar nicht die Impffrage direkt. Weil natürlich weiterhin im Raum stehen bleibt, das eine Impfung helfen wird.

    Aber es weisst auf einen “Mechanismus” der Verbreitung hin, der erklären könnte, wieso die bisherigen Maßnahmen nur unzureichend funktionieren. Angesichts könnte es wirkungsvoller sein, nicht die reale Wirklichkeit mit Maßnahmen der Isolierung und Abstand zu regulieren, sondern die virtuelle Wirklichkeit (plus Reiseregeln), damit Identitäten, die sich fremd sind, sich nicht auf dieser Ebene begegnen können.

    Das dies nur eine verzögerung der trotzdem bestehenden Pandemie-Situation bedeuten wird, ist auch wieder wahr.
    Aber wenn die Impfung wirklich funktioniert, dann…. gibt es ja Hoffnung, oder?

    Dabei ist mir nicht ganz klar, was Impfung und Infektion unterscheiden soll. Ausser eben, das die Impfung vor schweren Folgen der Infektion schützen soll.
    Das klingt zwar schlüssig und scheint sich jetzt zu beweisen, aber man muß auch einberechnen, das die Impfung nun erst kam, als schon ein teil der Bevölkerung, die dafür anfällig war, gestorben ist. Und es ist davon auszugehen, das dieser teil, der früh erkrankte und verstarb, wahrscheinlich auch durch die Impfung gesundheitliche Probleme bekommen hätte. Sodass die Ausage, die Impfung schütze vor schweren Folgen der Ansteckung, nur teilweise und vor allem bei Menschen zutrifft, die eh keine schweren Folgen der Ansteckung zu befürchten hätten.

    Aber das ist alles keine neue Szenerie. Leider aber führt die Seuche seltsamerweise dazu, das die Menschen schneller vergessen und viele als bekannt geltende Details schnell wieder keine Rolle mehr spielen.

    Wenn man die Schlagzeilen und politische Boteschaften so betrachtet, komtm dabei herraus, das, wenn die Bevölkerung auf Zuruf schneller und zustimmender reagiert, es sich dann um die bessere Herrschaftssituation handelt, als wenn von überall her kritik und Ablehnung käme.
    ich erwähne das nur, weil in gewisser Möglichkeit der strategischen praxis dann die Erfahrungen aus dem Starkult relevant werden, und die Reaktion des Volkes daran gemessen wird, wie erfüllend sie zustimmung gibt, wenn zur Reaktion (durch Botschaft) aufgerufen wird. Was nur heisst, das, wenn irgendwer irgendwas in die massenmediale Öffentlichkeit emittiert, dann die Reaktionen ausgewertet werden können und daran gemessen werden kann, inwieweit man noch weiter die Maßnahmen durchfphren muß, die dazu nötig sind, das dieses gesamte Volk endlich loyal zur Regierung ist. Sozusagen, das man sich eben doch tatsächlich sein Volk aussuchen kann, wenn es einem nicht gefällt. Man muß es dann nur hinreichend manipulieren und die Störfaktoren in der Population beseitigen (was auch heisst: Töten), und wenn es auch nur “theologische” Tötung sei).

  58. @ Kommentatorenfreund “Jolly / Joker” und hierzu, was ist da los ? :
    Ich kann hier nicht folgen, hab doch nur zitiert und abgewiesen.
    hab doch einem “Nasenbär” gegengeredet,
    mit freundlichen Grüßen
    Dr. Webbaer

    PS:
    Danke, es war “schön”.

  59. Ich habe ernsthafte Probleme mit nicht so Gemeintem, war auch stets freundlich, nicht selten auch : auf die Schulter klopfend, auszukommen, amderweitig, bin schon lange “im Geschäft”, völlig von i.p. Leserbrief eingereichten wegggehend und dieses Re-Feedback meinend :

    @Webbär: Was für ein Kurzschluss. Hinter z.B. Substanzkonsum stehen u.A. a) eine Tabak- und Werbelobby, b) oft ist er Reaktion auf soziale Härten, c) der Staat verdient daran ordentlich mit, d) es handelt sich um keine außergewöhnliche Krisensituation, sondern die “Normalität”, mit der unser Gesundheitssystem gewachsen ist usw. usf.

    MFG
    WB (der sich gerne auch die Anrede ‘Webbaer’ wünscht, also ohne doitsche Umlaute und gerne auch angemessen ansonsten)

  60. @Dr. Webbaer

    “Woher kommt also der Hass vieler Ungeimpfter auf Geimpfte?”

    Ich kann hier nicht folgen, hab doch nur zitiert und abgewiesen.

    Nun, aus dem Kontext in dem @Mutiertes Spike-Protein die Frage stellte, ergibt sich, dass sie eigentlich lauten sollte: Woher kommt also der Hass vieler Geimpfter auf Ungeimpfte?

    Vielleicht wollen Sie auch das abweisen, dass es einen Hass in diese Richtung gibt?

    Falls ja, würde ich Ihnen auch hier widersprechen und Ihnen einen geschärften Blick, soweit noch möglich, ins OLT empfehlen. Da ist nicht nur Gehässigkeit im Spiel, da spürt man den echten Hass doch deutlich, so meine ich.

  61. Derartige Nebensätze weiß der sozusagen super-objektive Webbaer (gerne ohne doitsche Umlaute und akademischem Grad) einzuordnen, nice1! :

    -> ‘Falls ja, würde ich Ihnen auch hier widersprechen und Ihnen einen geschärften Blick, soweit noch möglich [Hervorhebung : Dr. Webbaer], ins OLT empfehlen.


    Gell, Sie haben dies ebenfalls nicht verstanden, Kommentatorenfreund “Joker | Jolly”, dass derartiger Befall durch Mikroorganismen sozusagen immer schon beim hier gemeinten Hominiden vorgelegen hat, nur zeitgenössisch jeweils anders bearbeitet worden ist?!

    MFG
    WB

  62. Bonuskommentar hierzu :
    Andere Kritiker verweisen auf Verträge mit den Impfherstellern, in denen die Risiken möglicher Langzeitfolgen von den Regierungen übernommen werden. Erst einmal war es wahrscheinlich ungeschickt, diese Verträge (wieder einmal) geheimhalten zu wollen. Das befeuerte Verschwörungstheorien.
    Diese Vertragsklausel ist aber kein Indiz dafür, dass es tatsächlich (noch unbekannte) Langzeitschäden gibt. Es ist schlicht unternehmerische Logik, möglichen Schaden vom Unternehmen fernzuhalten. [Artikeltext, Einschätzung : Dr. Stephan Schleim.

    Hier mal zu den Impffolgen das Paul-Ehrlich-Institut, das klingt auch ehrlich und dem wird ja oft auch gefolgt, zitiert :

    -> https://www.pei.de/SharedDocs/Downloads/DE/newsroom/dossiers/sicherheitsberichte/sicherheitsbericht-27-12-bis-31-08-21.pdf?__blob=publicationFile&v=6 (Seite 13 und 14, Proben : ‘In 15.122 Verdachtsfällen wurden schwerwiegende unerwünschte Reaktionen
    gemeldet.’ + ‘In 1.450 Verdachtsfallmeldungen wurde über einen tödlichen Ausgang in
    unterschiedlichem zeitlichem Abstand zur Impfung berichtet’)

    D.h. es wird auch an den Folgen der Impfung gestorben, Dr. Webbaer will diese Datenlage hervorstellen, es starben womöglich mehr als tausend Personen an der “Corona”-Impfung, über ihr Alter ist nicht direkt berichtet worden, es ist aber ein Unterschied, ob eine geimpfte Person in jungem Alter so verstirbt oder eine vorerkrankte und (sehr) alte Person an “Corona” direkt.


    Insofern sind Güterabwägungen bei oder von den möglichen Rezipienten vorzunehmen, die auch negativ ausfallen dürfen, solange derartige Impfung nicht pflichtig und Nicht-Impfung so strafbewehrt wird.

    Bei Heranwachsenden rät Dr. Webbaer zur Nicht-Impfung.

    MFG
    WB (der derart, wie zitiert “unternehmerische Logik”, mag, lange im Geschäft auch, Nice1!, so abär nicht zu besonderer Zustimmung zu Sinn und Inhalt des hiesigen dankenswerterweise bereit gestellten Inhalts sozusagen angestachelt wird)

  63. Und genauso ist es schlicht gesunder Menschenverstand, mögliche Impfschäden von meinem Körper fernhalten.

    Die Wahrscheinlichkeit eines Longcovidimpfschadens ist etwa so hoch, wie die von einem Meteoriten getroffen zu werden. Und diese Wahrscheinlichkeit ist nicht vom Impfstatus abhängig.

    Deshalb nehme ich das Risiko einer Infektion auf mich.

    Und dieses Risiko ist für Ungeimpfte um ein Vielfaches höher als für Geimpfte. In den Wochenberichten des RKI kann sich jeder, der ein weinig rechnen kann, sein Risiko in seiner eigenen Altersgruppe ermitteln. Und da ich mich halt so gerne wiederhole, zeig ich noch mal, wie das geht.

    https://www.rki.de/DE/Content/InfAZ/N/Neuartiges_Coronavirus/Situationsberichte/Wochenbericht/Wochenberichte_Tab.html;jsessionid=B0A9ED785C9D4FADEC7746CEC5B97178.internet071?nn=13490888

    28.10, Altersgruppe 60+ Todesrisiko
    In den Nenner des 1.Bruchs schreibt man die allgemeine Impfquote und im 2. Bruch die Todesfälle unter den Geimpften der Altersgruppe. In den Nennern ergänzt man auf 100%.

    (84,6/15,4)/(45/55)=47/7~6,71=erhöhtes Sterberisiko gegenüber Ungeimpften,

    Sie haben sich eben Gehorsamkeit als “Solidarität” verkaufen lassen. Ich sehe nichts solidarisches daran zu gehorchen.

    Sie werfen uns also vor, dass wenn wir nicht besoffen Auto fahren, dass wir das dann nur aus Gehorsam tun! Also Leute knallt euch ruhig mal richtig voll und lasst euch von denen da oben nichts sagen. Die Fußgänger sollen rechtzeitig zur Seite springen, wenn ihr daher kommt.

    Nein dann heisst es, dass ich nach jahrzentlangem Einzahlen in die Krankenkasse auch mal eine etwas teurere Leistung in Anspruch nehme.
    Bisher war die Einzahl-/Inanspruchname-Quote bei mir sehr zu meinen Ungunsten, so das ich da keine moralischen Bedenken habe.

    Ich gehe auch recht selten zum Arzt und habe der Krankenkasse bisher mehr gegeben als ich von ihr erhalten habe. Und das soll möglichst noch lange so bleiben.

    Woher kommt also der Hass vieler Ungeimpfter auf Geimpfte? Eine mögliche Erklärung könnte sein, dass Geimpfte mit ihrem experimentellen Impfstoff ein gewisses Risiko eingegangen sind und nun argwöhnisch auf diejenigen blicken, die Geduld bewiesen haben. Man hat selbst ein Opfer gebracht

    Das ist wohl das typische Denkmuster eines Verschwörungsmystikers. Ockhamsches Rasiermesser? Was ist das? Braucht man das zum Brotschneiden?
    Das Einfachste und Naheliegende ist doch: Man ist auf euch sauer. Wäret ihr auch geimpft, könnten wir schon lange die Masken fallen lassen. Die Belastung des Krankenhauspersonals wäre erträglich. Und die könnten sich mehr um die anderen Kranken kümmern. Und wieso Geduld? Und wer hat hier ein Opfer gebracht? Also ich nicht. Ich hab mir nur 2 Pieks geben lassen

    Schweden/Flordia haben seit zig Monaten weder Impflicht noch Lockdown und geringere Inzidenden als New York, Israel…
    Impftote gibt es, einfach mal googeln: https://www.berliner-zeitung.de/news/frau-stirbt-mit-32-an-corona-impfung-das-sagt-ihre-mutter-li.188936

    Wo sind die Belege für die 1. Behauptung? Und da schreibt irgendeine Berliner Tageszeitung. “48 Menschen starben in Deutschland wahrscheinlich wegen der Impfung” Da folgert also jemand, dass wenn zuerst A passiert und dann B, dann muss A die Ursache von B sein.

    Der Schwindel mit den 95% kommt ja aus der urspr. Studie des BioNTech Impfstoffs und basiert auf einem simplen statistischen Trick.

    Wen interessieren denn gestellte Studien die 2020 statt fanden? Schaut euch die RKI-Wochenberichte an. Das sind Studien unter echten Bedingungen. Und da kann man ganz genau heraus lesen, wie viel Menschen wegen Nichtimpfung gestorben sind, sofern man ein wenig rechnen kann.

  64. @ anton reutlinger,

    Darum geht es in der Tat in den Zeilen darunter:

    Suspected COVID-19 cases that occurred within 7 days after any vaccination were 409 in the vaccine group vs. 287 in the placebo group. It is possible that the imbalance in suspected COVID-19 cases occurring in the 7 days postvaccination represents vaccine reactogenicity with symptoms that overlap with those of COVID-19. Overall though, these data do not raise a concern that protocol-specified reporting of suspected, but unconfirmed COVID-19 cases could have masked clinically significant adverse events that would not have otherwise been detected.

    Das ist verständlich. Kurz nach der Impfung sind Reaktionen zu erwarten, die den eigentlich Symptomen der Krankheit gleichen.

    Die Zahlen darüber, die ich zitierte, sind die vom Abschluss des Protokolls, also grob zwei Monate nach Zweitimpfung, als man die PCR-Tests machte, durch die “Verdachtsfälle” bestätigt oder verworfen wurden. Deswegen sind diese Zahlen relevant für die sog. Impfeffektivität.

    Denn wie ich das verstehe behaupten Sie, dass immer wenn ein Symptom und ein positiver PCR-Test zusammen auftreten, ein kausaler Zusammenhang besteht und nur SARS-COV2 der Bösewicht sein kann. Dieser ist sozusagen der Superstar unter den Krankheitserregern und sticht jeden anderen Erreger in Priorität aus.

    Wie können Sie denn diesen Beweis erbringen bei einem Krankheitserreger mit angeblich unspezifischem Symptomspektrum? Oder ist es doch nicht unspezifisch und der SARS-COV2-Erreger verursacht einen Krankheitsverlauf mit eindeutig unterscheidbaren Veränderungen in der Lunge, worauf diese 50 Obkuktionen aus dem Februar hindeuten?

    https://www.aerztezeitung.de/Politik/Obduktion-von-Corona-Toten-Wir-werden-demuetig-416937.html

    Wenn dies tatsächlich der Fall sein sollte und nur wenige Corona-Intensivpatienten zeigen genau diese Veränderungen am Gewebe, dann könnten Sie bei den meisten “schweren Verläufen” nicht ausschließen, dass das Vorhandensein des Erregers nicht kausal ist und das ganze Corona-Narrativ würde einstürzen. Wir können uns denken, warum man es bei ein Symptom + positivem PCR-Test belässt.

    @ Joker,

    Ich persönlich kenne einen solchen Fall. Geimpfte sind für ihn bösartig und gefährlich, weil die irgendwie mit Bill Gates unter einer Decke stecken und schreckliche Sachen verbreiten.

    Ich persönlich mag Bill Gates. Ich habe durch Moderna-Aktien an dieser Fake-Pandemie sogar Geld verdient, was für einen ungeimpften Lockdown-Gegner eine gewisse Ironie ist, nicht wahr?

  65. @ Julian Apostata,

    Das Einfachste und Naheliegende ist doch: Man ist auf euch sauer. Wäret ihr auch geimpft, könnten wir schon lange die Masken fallen lassen.

    Für mich ist das, ohne unhöflich sein zu wollen, der Geist des Untertans, der unter Stockholm-Syndrom leidet. Sie glauben also ernsthaft, dass die Regierung, die Ihnen letztes Jahr einen kurzen Lockdown zum “Glätten der Kurve” verkauft hat und heute nach 18 Monaten kurz davor steht, ihre verbliebenen Bürgerrechte an ein digitales Impfzertifikat zu binden, welches Sie dann bei Eintritt in Kino, Museum, Flugzeug, Fitnesscenter etc. vorzeigen müssen, sich um Ihre Freiheitsrechte schert?

  66. Peter Müller
    02.11.2021, 12:14 Uhr

    Ihre Logik ist faszinierend, die ~95.000 gezählten Toten sind … nichts, der Umstand, dass viele Menschen sich in einer quasi heiligen Ehrfurcht so zurückgehalten haben, dass sie sich nicht mit den ansonsten üblichen saisonalen Infektionen zu Tode gebracht haben – genau das nehmen Sie als angeblichen Beweis, das Covid-19 “ungefährlich” sei?
    Mein unmaßgeblicher Schluss aus der “Untersterblichkeitszahl” ist, dass wir uns augenscheinlich vorher einen Dreck um Allerweltsinfektionen gekümmert und die daraus folgenen Tode als “Kollateraleffekt” billigend in Kauf genommen haben.
    Wenn wir die Zahlen der Nicht-Tode genau aufschlüsseln und in Relation zu den Coronamaßnahmen setzen, könn(t)en wir lernen, worauf wir denn sonst noch im Umgang miteinander achten sollten – “live long and prosper” – wäre das Motto dazu.
    Aber vielleicht müssten wir dann auf das orgasmusähnliche Abknutschen nach einem geschossenen Tor ( “er hat einen reingekriegt!” ) und vergleichbare Aktionen des gesellschaftlichen Lebens verzichten …

  67. Covid ist keine mit Grippe vergleichbare Erkrankung. Covid ist eine “ganzheitliche” Epitheliumerkrankung.
    Anfangs wurde atypische Lungenentzündung diagnostiziert, weil das Virus über die Atemwege kommt.
    Epithel ist als Grundgewebeart überall, Nierenversagen, Herzinfarkt, Gehirnschlag usw können auftreten.
    Rußland hat über Covid hinaus dramatische Übersterblichkeit, weil dort als Todesursache nur Lunge zählt,
    andere corona-assozierte Todesfälle werden anders zugeordnet, obwohl Gewebeschäden eindeutig sind.
    Die ganze Palette der möglichen Organschäden sieht man bei “Genesenen” an den long-Covid-Diagnosen.

    Jetzt haben wir weltweit bereits 5 Mio so bestätigte Todesfälle, mit Dunkelziffer hochgerechnet 15 Mio!
    Covid-Corona ist damit in den letzten 100 Jahren zur drittschlimmsten Virus-Pandemie geworden.
    – spanische Grippe 1918/19 50-100 Mio Opfer bei der damaligen Medizin
    – an AIDS starben bisher über 35 Mio Menschen, noch gibt es keinen Impfstoff
    – Asiatische Grippe 1 Mio plus Honkong-Grippe 1 Mio (1957 bis 1970)

    Zum Vergleich Grippe kommt durchschnittlich auf weniger als 0,5 Mio Todesfälle jährlich, wir impfen.
    Was Covid in einem Jahr gebracht hat, da braucht Grippe 10 Jahre, wir diskutieren über’s Impfen???

  68. @Spikes-Protein
    Sie haben offensichtlich wieder nicht verstanden worum es geht. In dem zitierten Bericht steht, dass 85% der Verstorbenen mit Corona-Infektion an Covid19 verstorben sind, während die übrigen 15% mit Covid19 verstorben sind, also an anderen Todesursachen. Das Virus greift die Lunge an, aber auch andere Organe, vor allem dann, wenn sie schon vorgeschädigt sind. Wenn die Lunge beschädigt ist, wird das Blut nicht mehr ausreichend mit Sauerstoff versorgt und in der Folge wird auch das Gehirn geschädigt oder stirbt letztlich ab.

    Sie interpretieren Berichte und Studien sehr oberflächlich und selektiv zugunsten Ihrer Vorurteile. In der aktuellen Heute-Sendung wurde wiederholt berichtet, dass Patienten in Intensivstationen zu 90% ungeimpft sind. In dem von Ihnen zitierten und angezweifelten FDA-Dokument zur Notfallzulassung steht eingangs, dass der Impfstoff von Pfizer/Biontech eine Wirkung von 95% hat.

  69. @Senf
    Es lag mir bereits auf der Zunge…
    @reutlinger
    Er hat verstanden…hat aber auch verstanden…

  70. @ anton reutlinger,

    Ich habe das FDA-Dokument nicht angezweifelt. Wir reden aneinander vorbei. Das ist aber auch in Ordnung. Ich schätze Sie trotzdem für Ihren Diskussionsstil. Sie werden nicht sarkastisch. Davon kann selbst ich mir eine Scheibe abschneiden.

    Letztendlich würde diese Diskussion auch nichts ändern. Ich werde mich nicht aus “Solidarität” impfen lassen und die Geimpften werden ihre Freiheiten nicht wiederbekommen, ganz gleich was die Ungeimpften tun.

  71. “Was” füttert eigentlich die Impfgegner? Dr.Krauss von der “Anstalt” des ZDF hat’s aufgegriffen:
    https://rotary.de/gesellschaft/alte-suenden-a-18993.html anthroposophische Ärzte sind dabei

    Die grüne Landesspitze machte zum 100. Geburtstag der Waldorfschule brav ihre Aufwartung. Schließlich handelt es sich um einen schwäbischen Exportschlager. Dass ein ziemlich direkter Weg von den Pastellfarben der Waldorfschule zur finsteren Impfparanoia der Querdenken-Bewegung führt, wird in Stuttgart erst langsam Gegenstand einer kritischen Debatte.

  72. @Herr Senf

    Covid ist keine mit Grippe vergleichbare Erkrankung.

    Doch, doch:

    Zum Vergleich Grippe kommt durchschnittlich auf weniger als 0,5 Mio Todesfälle jährlich

  73. Kann man die Grippe überhaupt statistisch mit Corona vergleichen? Die Datenerhebung für die Grippe erfolgt nach Differenz der Sterblichkeit in den Influenzamonaten im Vergleich zum Rest. Sagte zumindest so n schlauer Typ aus der Charite.

    https://www.deutschlandfunknova.de/beitrag/virologie-christian-drosten-keine-sorge-fuer-normalbuerger

    Wie werden nochmal “Corona-Tote” gezählt? Wir wissen es langsam. Kein Wunder, dass es mittlerweile heißt: Die Grippe heißt jetzt Corona. Und Raider heißt jetzt Twix. Sonst ändert sich Nix.

  74. @Joker
    Man kann auch Äpfel mit Birnen vergleichen, beides ist Obst. Es bringt keine neue Erkenntnis, sondern unnötige Missverständnisse.

    Grippetote werden amtlich nicht explizit gezählt, deshalb gibt es nur Schätzungen mit Übersterblichkeit. Anscheinend hat es sich noch nicht herumgesprochen, dass das Coronavirus sehr viel ansteckender und tödlicher ist als das Grippevirus.

  75. @anton reutlinger

    Anscheinend hat es sich noch nicht herumgesprochen, dass das Coronavirus sehr viel ansteckender und tödlicher ist als das Grippevirus.

    Vergleichen Sie hier oder vergleichen Sie nicht? Vergleichen Sie hier Äpfel mit Birnen? Behaupten Sie, ihr Vergleich bringe keine neuen Erkenntnisse, sondern nur Missverständnisse?

  76. @Joker
    Im Grunde gebe ich Ihnen sogar recht. Wenn man aber sagt “‘Äpfel sind nichts anderes als Birnen”, dann ist der Vergleich falsch und unsinnig. Wenn man dagegen auf die Unterschiede hinweist, dann ist ein Vergleich sinnvoll. Man kann etwas Unbekanntes mit etwas Bekanntem vergleichen, indem man sowohl auf Gemeinsamkeiten (Zugehörigkeit zur Obermenge “Obst”) als auch auf Unterschiede hinweist. Eine Gleichmachung Apfel = Birne abstrahiert von den unterschiedlichen Eigenschaften, oder ignoriert sie einfach.

  77. “Ihre Logik ist faszinierend, die ~95.000 gezählten Toten sind … nichts..”

    Dann mal anders gefragt: Bei welcher anderen Seuche in der Geschichte gab es jemals eine Untersterblichkeit?

  78. @Müller, wie ist Untersterblichkeit definiert? Und schon haben Sie die Lösung.
    Über-/Untersterblichkeit sind leider häufig mißinterpretierte “reine” demografische Werte,
    die durch fleißiges Rechnen den Zustand der “gesamten Volksgesundheit” vorhersagen sollen,
    aber ebenso fleißig die Ursachen im Rechenweg mitteln und maskieren, also keine Diagnose.
    Untersterblichkeit drückt die Übersterblichkeit in den Skat, wenn es vorher “Ernteeffekte” gab.

  79. @Herr Senf

    Nein, die Über-/Untersterblichkeit ist quasi wie die Bilanz einer Firma zum Jahresende. Wenn eine Firma das ganze Jahr lang jammert, dass man starke Verluste macht aber am Ende des Jahres sogar ein Gewinn herauskommt, hat die Firma offensichtlich etwas verschwiegen.

  80. @Peter Müller

    Wenn eine Firma das ganze Jahr lang jammert, dass man starke Verluste macht aber am Ende des Jahres sogar ein Gewinn herauskommt, hat die Firma offensichtlich etwas verschwiegen.

    Wenn eine Firma das ganze Jahr lang jammert, dass man starke Verluste mit den Ladengeschäften macht, aber am Ende des Jahres sogar ein Gewinn herauskommt, dank des Webshops, hat die Firma offensichtlich was verschwiegen? Was verschweigen Sie?

  81. Peter Müller
    03.11.2021, 09:25 Uhr

    Die Frage ist doch wohl nicht ganz ernst gemeint, oder?

    Eine “Untersterblichkeit” kann es erst geben, seit dem man die Todeszahlen und deren Ursachen einigermaßen verlässlich erfasst und aufzeichnet. Seit wann ist das der Fall ( ernstgemeinte Frage )?

    Dann “brauchen” wir auch noch eine Pandemie, die als solche erkannt und bewertet wird. Wer im Mittelalter hat die Pest als Pandemie erkannt und welche Schutzmaßnahmen hat es denn gegeben?
    Wir haben bisher auch “Grippe” meines Wissens noch nie als Pandemie bezeichnet, selbst die “Spanische Grippe” am Ende von WWI wurde aus gewissen Gründen quasi “unter den Teppich gekehrt” bzw die Toten unter die Erde gebracht, ohne die eigentlichen Ursachen zu benennen. Insofern konnten die meisten Menschen damals auch keine persönlichen Vorsichtsmaßnahmen treffen, die sie vor der Grippe und womöglich vor anderen Gefahren geschützt hätten.
    In dem Buch “Pest, Not und schwere Plagen” wird ( in der Jetzt-Zeit ) hochgerechnet, dass in Folge von einfachen Infektionskrankheiten und sonstigen Krankheiten in den Jahren nach den Napoleonischen Kriegen ( in den “Jahren ohne Sommer” ) im Gebiet “Deutschland” pro 100 k Einwohner ( oder so ) mehr Menschen gestorben sind als im letzten vollen Kriegsjahr 1944 im Vergleichsgebiet. Die Menschen damals hatten nicht den Überblick ( die Statistik ) wie wir heute, sie hatten auch nicht die Möglichkeiten zum Selbstschutz. Ich gehe auch davon aus, dass 1944 die Todeszahlen so nicht publik gemacht worden sind.

    Die heutigen Zahlen sind interessant aus der Hionsicht, dass wir lernen könnten, was wir bisher mangels Aufmerksamkeit übersehen haben – wenn wir denn lernwillig und lernfähig sind.

  82. @ Kommentatorenfreund Karl Maier und hierzu kurz :

    Ihre Logik ist faszinierend, die ~95.000 gezählten Toten sind … nichts, der Umstand, dass viele Menschen sich in einer quasi heiligen Ehrfurcht so zurückgehalten haben, dass sie sich nicht mit den ansonsten üblichen saisonalen Infektionen zu Tode gebracht haben – genau das nehmen Sie als angeblichen Beweis, das Covid-19 “ungefährlich” sei? [Ihre Nachricht an Herrn Peter Müller]

    Also es ist so, dass es keine Coronatote-Definition gibt, was es gibt, ist eine gewisse Übersterblichkeit, vielleicht nicht in jedem Land, aber insgesamt ist sie nachweislich, sie ist nicht sehr hoch, sie trifft meist auch Alte und (schwer) Vorerkrankte – eine Ergänzung, die nicht verharmlosen soll.

    Dennoch liegt eine minderschwere Epidemie vor, oder Endemie, denn der durchschnittliche Lebenszeitverlust pro Person liegt nicht viel höher als bei einem Lebenstag (!), an dieser Stelle wäre aus diesseitiger Sicht dann auch 1.) mit dem Verlust an Lebensqualität zu vergleichen 2.) mit der Gefahr für die (liberale) Demokratie, es werden ja recht “trocken” sogenannte Grundrechte ausgesetzt, die auf nationaler Ebene sogenannte Menschenrechte (vs. Bärenrechte) implementieren und 3.) mit anderen Gefahren / Risiken (Adipositas z.B. oder “schwules Rudenverhalten” oder die Raucherei, die hat Dr. W bspw. ca. drei Jahre seines Lebens gekostet, es wird hier einem im Web verfügbaren “Raucherrechner” vertraut, rein statistisch, dankenswerterweise, man kann ja auch Glück haben und nicht an Raucherkrankheiten, sondern sozusagen später gesund versterben) zu vergleichen.


    Gerne auch “Finger weg vom Solidaritätsgedanken!”, Dr. Webbaer ist zwar sozusagen ursisch-zynischer Liberalist, aber auch ordoliberal und wie gemeinten Sozialsystemen (grundsätzlich!) freundlich gegenüber eingestellt.
    (“Corona” ist neben anderen Gegenständen des nunmehr täglichen politischem Gebrauchs, vergleiche auch mit der sehr “divisive” sogenannten Identitätspolitik dem Anschein nach ein weiterer Killer sozusagen des an sich wünschenswerten gesellschaftlichen Zusammenhalts.)

    Mit freundlichen Grüßen
    Dr. Webbaer

  83. Dann mal anders gefragt: Bei welcher anderen Seuche in der Geschichte gab es jemals eine Untersterblichkeit? [Herr Peter Müller]

    Es gibt eine leichte Übersterblichkeit, nicht in jedem Land, auch die Alterskohorten sind zu beachten – gerne diesen Sachverhalt, den der Schreiber dieser Zeilen auch i.p. CDC, EUROMOMO und i.p. Statistisches Bundesamt webverweisen könnte (aber nicht tut, weil es hier einen Filter für Nachrichten / Kommentare mit mehr als zwei Webverweisen gibt (was einen Grund haben mag, Dr. W will an dieser Stelle nicht nagen)), zK nehmen, danke + danke.

    Mit freundlichen Grüßen
    Dr. Webbaer (der sich auch i.p. Impffolgen ausbreiten könnte, hier ist (erst einmal) zwischen Langzeitfolgen (deren Beginn zeitnah zur Impfung erfolgt, so näherungsweise nachweislich wird bzw. vermutet werden darf) und Spätfolgen (die es sicherlich gibt, oft geleugnet werden, weil sie schwer, sehr schwer mit einer vor vielen Jahren erfolgten Impfung statistisch, wissenschaftlich in Zusammenhang gebracht werden kann, wenn so nicht direkt sozusagen ins Auge sticht) zu unterscheiden, gerne auch : streng)

    PS :
    Vielleicht (nochmals (und immer wieder sozusagen)) im Abgang noch ein kleines Lob dem werten hiesigen Inhaltegeber, der u.a auch philosophisch gebildet auch schwierige Themen anzupacken weiß, als originärer Denker auch Ideen hat (was gar nicht so-o selbstverständlich ist, heutzutage))!

  84. @WB: der durchschnittliche Lebensverlust der Verstorbenen liegt bei 5(!) Jahren, 5 Jahre weg.
    Wer kommt denn auf die absurde Ideeeeee, das über die Gesamtbevölkerung zu mitteln?
    Erstmalig ist seit etwa 100 Jahren in ganz Europa die Lebenserwartung (ab Geburt) gesunken!
    Das machen 1,3 Mio um 5 Jahre zu früh Verstorbene, davon viele sonst noch gut gesund.

  85. @Senf: Lebenserwartung

    Nur mal so am Rande: Dass die Lebenserwartung immer nur steigt, kann man so nicht sagen. Es kommt schon drauf an, auf welche Gruppe man sich konzentriert. Und bei der Lebenserwartung gibt es mitunter große Unterschiede zwischen Geschlechtern und in Abhängigkeit vom Vermögen. In einem sozialen und demokratischen Rechtsstaat halte ich das für einen Skandal.

    Das nur als Richtigstellung. Um dieses Thema geht es diesmal nicht.

  86. Bonuskommentar @ Kommentatorenfreund Julian Apostata hierzu :

    Woher kommt also der Hass vieler Ungeimpfter auf Geimpfte? Eine mögliche Erklärung könnte sein, dass Geimpfte mit ihrem experimentellen Impfstoff ein gewisses Risiko eingegangen sind und nun argwöhnisch auf diejenigen blicken, die Geduld bewiesen haben. Man hat selbst ein Opfer gebracht. [Kommentator X, vermutlich : dieses Kommentariat]

    Das ist wohl das typische Denkmuster eines Verschwörungsmystikers. Ockhamsches Rasiermesser? Was ist das? Braucht man das zum Brotschneiden?

    Soziodynamisch, gesellschaftspychologisch muss “Kommentator X” nicht falsch liegen, er meinte womöglich konträr den ‘Hass vieler Geimpfter auf Ungeimpfte’, eine Einschätzung, die diesseitig nur ansatzweise geteilt wird, “divisive” wirkt “Corona” leider schon, es liegt sozusagen ein Killer des gesellschaftlichen an sich wünschenswerten Zusammenhalts vor, oder?

    Ockhams Rat meint eigentlich nur, dass bei anliegender Theoretisierung (“Sichtenbildung”) mit möglichst wenigen Entitäten ausgekommen werden darf, der Sichtenbildende gerne ein wenig dull minimieren darf, nicht verkomplizieren soll.
    (Böse formuliert, weil sozusagen jede Theorie falsch ist und es “nur” darauf ankommt ihr Verfallsdatum abzuwarten, nein!, Dr. W ist Anhänger, nicht Gegner der szientifischen Methode, erklärt sie abär gerne.)
    Nicht angelegt werden kann Occam’s Razor, wenn bereits theoretisiert worden ist, Occam’s Razor bedeutet Rat, kein Argument.


    Was hier beide (!) Seiten machen, ist die emotionale, gar ungünstig moralische Aufladung eines bestehenden, aus Sicht aller eigentlich anerkannten, Problems.
    Dr. W da nicht mitmachen tun.

    Mit freundlichen Grüßen
    Dr. Webbaer (außer bei Kommentatorenfreund “Jolly | Joker”, bei “Dr. Huhn” und bei einigen anderen noch, denen er ebenfalls manchmal wie gemeint ungünstig kommt, dann meist bewusst, spaßeshalber, ironisierend, brachial experimentell teils auch und den guten Habitus meinend – bei Herrn Dr. Stephan Schleim eher nicht (mehr), hat sich dort nicht bewährt)

  87. @ Kommentatorenfreund “Herr Juas” (Dr. W schreibt an dieser Stelle gerne mal groß, auch um freundlich zu sein und um einen gewissen Respekt anzuzeigen) :

    @WB: der durchschnittliche Lebensverlust der Verstorbenen liegt bei 5(!) Jahren, 5 Jahre weg.
    Wer kommt denn auf die absurde Ideeeeee, das über die Gesamtbevölkerung zu mitteln?

    Das verständige Subjekt kümmert sich, sozusagen im statistischen Sinne, im Sinne auch der sog. Verantwortungsethik um die Menge, nicht um Einzelne, rührt dort nicht herum – was es angreifbar macht, Sie selbst sehen’s anscheinend anders, no problemo hier.

    Mit freundlichen Grüßen
    Dr. Webbaer (der Gefühlsethik selbst “nicht so-o mag”, aber jedem das Seine, jeder nach seiner Fasson und jeder so gut er kann; auch der wissenschaftliche Zusammenhang, der in wissenschaftsnahen WebLogs bereit gestellt wird, spricht womöglich so entgegen)

  88. Christopher Hitchens ist dem Schreibär dieser Zeilen bekannt, sein Talent ebenso.
    Kritisch würde Dr. Webbaer bei dieser sozusagen Ergänzung zu Occams Rat anmerken wollen, dass Postulate, im Metaphysischen auch, dort ist (am besten und wie einige meinen) Theorie, Metatheorie dann, unfalsifizierbar (sonst läge Naturwissenschaft vor) und unverifizierbar (sonst läge Tautologie oder Formalwissenschaft vor, gerne auch : Mathematik), gut, weil notwendig sind.

    Was Sie meinen, “Senfie”, ist die Evidenzbasiertheit im naturwissenschaftlichen Sinne, Dr. Webbaer ist da (erst einmal) ganz bei Ihnen, eine sozusagen gute physikalische Theorie legt in puncto Bringschuld vor, bleibt am besten bereits am Anfang empirisch adäquat. [1]
    Andere Theorie wird aber so nicht direkt falsch, wenn sie (zumindest : zeitweise) ungelegt bleibt.

    A bisserl vom Thema weggehen geht’s schon, oder?, Dr. Webbaer bleibt in diesem Zusammenhang gerne bei möglichem Missverstehen von Ockhams Messer.

    Mit freundlichen Grüßen
    Dr. Webbaer (der hier vom Thema wegging, dem hiesigen werten Inhaltegeber u.a für seine Toleranz dankt)

    [1]
    U.a. Bas van Fraassen, Dr. Webbaers Lieblings-Philosoph aktuelle, erklärt hier gerne, dort gerne mal reinlesen, audiovisuelle Dokumente stehen im Web bereit-

  89. *
    Andere Theorie wird aber so nicht direkt falsch, wenn sie (zumindest : zeitweise) un[b]elegt bleibt.

  90. “Andere Theorie wird aber so nicht direkt falsch, wenn sie (zumindest : zeitweise) ungelegt bleibt.”

    Nein, aber sie sind ohne Beleg erst einmal rein Phantasiegebilde. Oder Fiktion, wenn man so möchte.
    Ohne irgendeine sinnvolle Argumentation kann man also die “Theorie”, die nur eine haltlose Behauptung ist, einfach übergehen.

  91. Theorie, auch physikalische, im Rahmen einer (kohärenten) Denkmöglichkeit, darf sich notiert bleiben, gerne auch mit dem Vorhaben, im Sinne des falsifikationistischen Verfahrens, ihr entgegen zu stehen, am besten : empiristisch, wobei die Empirie, das Erfassungswesen ist gemeint, schon “ganz nett wäre”.

    Dei szientifische Methode greift genau so :

    -> https://en.wikipedia.org/wiki/Scientific_method (aus irgendwelchen Gründen gibt es in der bekannten Online-Enzyklopädie hier kein sog. Lemma, lol)

    Es sollte weiter oben heißen :

    Andere Theorie wird aber so nicht direkt falsch, wenn sie (zumindest : zeitweise) un[b]elegt bleibt.

    Postalate, Ideen, Bilder, Builder sozusagen bleiben bei hier gemeinter wissenschaftlicher Veranstaltung willkommen.
    Es darf und gilt idF zu falsifizieren.

    Ideen wichtich (mittelniederdeutsch), bleibend.

    Mit freundlichem Grüßen
    Dr. Webbaer

  92. @100 Ich denke mal, Dr. Webbaer hat die Schlußworte unter diesen entgleisten Thread gesprochen 😉

  93. +1

    WB

    [Bleiben Sie doch mal sachlich und unterlassen Sie so einen Kinderkram! S. Schleim]

  94. Dr. Webbaer
    03.11.2021, 18:38 Uhr
    Dennoch liegt eine minderschwere Epidemie vor, oder Endemie, denn der durchschnittliche Lebenszeitverlust pro Person liegt nicht viel höher als bei einem Lebenstag (!)

    “Dulce et decorum est pro libertate aliorum mori” oder “Husch, husch, ab in die Urne…” – ist es das, was Sie sagen wollen?

  95. Wie werden nochmal “Corona-Tote” gezählt?

    Das spielt eigentlich überhaupt keine Rolle. Ich bring noch mal das Rechenbeispiel von oben.

    (84,6/15,4)/(45/55)=47/7~6,71
    Denn wenn die Ärzte tatsächlich so blöd wären und nicht die Todesursache feststellen könnten, dann müsste man mit (i*45%Geimpfrte)/(i*55%Ungeimpfte) rechnen. Und wer Bruch rechnen kann, der sieht, dass der Irrtumsfaktor i sich raus kürzt.

    Das Sterberisiko von 6,71 könnte übrigens deutlich höher liegen wenn die echte Impfquote höher liegt, weil beispielsweise nicht alle Hausärzte die Zahlen immer korrekt weiter gegeben hätten. Beispiel:
    (86/14)/(45/55)~7,51
    Und wenn noch jemand mit einem gefälschten Impfpass an Covid gestorben wäre, dann schaut die Sache so aus.
    (86/14)/(44/56)~7,82
    Und trotzdem wird oft jegliche Realität beiseite geschoben und immer wieder das Märchen erzählt, die Impfstoffe wären fast wirkungslos.
    Für diejenigen, die nicht so gern rechnen, hab ich diese Rechenhilfe erstellt.
    https://www.geogebra.org/m/rq86m5eu

  96. Also, ga-anz sachlich, wenn eine Gefahr droht, “Corona” ist eine Gefahr, ein sog. Risiko (vgl. auch mit Luhmann, der teils wohl auch von dieser (richtigen) Idee sozusagen gelebt hat) liegt nicht vor, denn es ist zuvor derart evozierend, induzierend nicht gehandelt worden, so dass i.p. sog. Risk-Reward-Überlegung vorgegangen werden kann, i.p. “Corona” ist alsp, wie einige meinen, auch bereits anfänglich die Gefahr erst einmal zu bestimmen zu suchen.

    Diese Gefahr ist nicht so-o groß, d.h. es wird nicht zeitnah und auch später nicht, vgl. mit “Long-Covid” bspw. gestorben. [1]


    Auf der anderen Seite stehen die (auch gesellschaftlichen, aber auch, direkt monetären) Kosten, hier bei :
    ‘Gerne auch “Finger weg vom Solidaritätsgedanken!”, Dr. Webbaer ist zwar sozusagen ursisch-zynischer Liberalist, aber auch ordoliberal und wie gemeinten Sozialsystemen (grundsätzlich!) freundlich gegenüber eingestellt.’ [Selbstzitat]’
    … bleibt Dr. Webbaer gerne beim Gedanken des gesellschaftlichen Zusammenhalts, der nicht ‘solidarisch’ genannt werden muss ( ‘Solidarität’ ist ein Konzept von Kollektivisten, die meinen, dass es gut sei bei “Aktionen” derart aufzutreten, dass Einzelne nicht aus der Menge herausgelöst, bedarfsweise verantwortlich gemacht werden können, auch : weil unerkennbar).


    Es gilt also (auch) zu rechnen, auch gesellschaftlich sozusagen :

    Gesellschaftlich bleibt wohl, allen womöglich unverkennbar, festzustellen, dass “Corona” extrem trennend wirkt, dass sog. Grundrechte, die jeweils staatlich implementiert, nichts anderes als die Menschenrechte meinen können, angegriffen werden und dass auch diskriminiert [1] wird.

    Mit freundlichen Grüßen
    Dr. Webbaer

    [1]
    Die ‘Diskriminierung’ meint die Unterscheidung, bedeutet sie, es ist dann irgendwann auf die Idee (vor etwas mehr als 50 Jahren) gekommen worden, dass dies nicht gut ist, soziologisch auch, wenn alle Personen doch vor dem Gesetz gleich sein sollen. – Dies, nur dieses (zweifelhafte) Wort meinend, die Idee im liberaler Demokratie unter Gleichen zu sein, ist wesentlich älter.

    Es gab dann, irgendwann, vor vielleicht 50 Jahren auch die Idee mit einem “to discriminate against” zu kommen, was der Schreiber dieser Zeilen zwar sprachlich nicht gut heißen kann, aber politisch-sprachlich halbwegs zu taugen scheint.

    Also in diese Richtung bewegt sich nun, “divisive”, einiges, die BRD wird hoffentlich noch aus diesem Schlamassel herausfinden.

  97. off topic – Info
    Die Sendung
    “ZDFzeit: Alles auf eine Karte – Der Wettlauf um den Impfstoff”
    ist in der Mediathek einsehbar.

    Der Beitrag ist sehr informativ gemacht und zeigt den Ablauf zur Entwicklung des Corona-Impfstoffes – hauptsächlich von Biontech/Curevac.
    Damit kann man gut verstehen, warum die Impfstoffentwicklung so schnell möglich war.

  98. Dr. Webbaer
    05.11.2021, 20:21 Uhr
    …unverkennbar, festzustellen, dass “Corona” extrem trennend wirkt …

    Ja, und besonders “diskrimierend” für die ~ 95 k Toten innerhalb der 2 Jahre, was in etwa pro Jahr jeweils dem Blutzoll von 15 Jahren Straßenverkehr ( letzte Zahlen ), 1 ¹/₄ Jahren Alkoholtoten, 5 Jahren Haushaltsunfällen und 5 Jahren Suiciden entspricht.
    Der einzige “Bonus” sind alle die, die wegen der Maßnahmen gegen Covid-19 nicht an anderen Infektionskrankheiten gestorben sind, was weniger pro Covid-19 spricht als vielmehr pro unserer Überheblichkeit und Geringschätzung aller solcher Infektionen in der Vergangenheit.

  99. Karl Maier
    06.11.2021, 19:36 Uhr

    Ja, und besonders “diskriminierend” für die ~ 95 k Toten

  100. In Portugal haben sich ca. 10% der Bevölkerung infiziert. Die damit verbundenen unangenehmen realen Erfahrungen haben dazu geführt, dass mittlerweile ca. 87% der Leute doppelt geimpft sind. Die Bevölkerung weiß um die Vorteile eines Impfschutzes

  101. Hier die nächste Impfwerbungspanne, ein Harvard-Professor der feststellt, dass die Impfung und COVID-19 Hospitalisierung in 68 Ländern nicht korreliert. So was aber auch, bei 95% Impfwirksamkeit…

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8481107/

    Dafür sind die Herzmuskelimpfnebenwirkungen v.a. bei Männern mittlerweile häufiger als die CFR von Männern < 40 Jr, das Netz voll von Fussballern die umkippen auf dem Platz. Ein Wissenschaftler würde mal fragen, ob es da einen Zusammenhang geben könnte statt sich mit Herrn Precht zu beschäftigen(?)

    @Herr "Senf"

    5 Jahre also im Schnitt, vor einem Jahr waren es noch 11 Jahre die ein Covid-19 Toter im Schnitt noch gelebt hätte. Vielleicht rechnen Sie mal vor oder verlinken eine Studie bevor Sie den Autor zum Löschen von Kommentaren auffordern oder schreiben mal mit einem Account statt einem quergedrehten, damit man weiß ob man Sie überhaupt ernst nehmen soll.

    Von ihnen täte mich eigentlich nur mal interessieren, bei welchem Kriterium die Pandemie beendet ist, nachdem Herr Lauterbach das schon nicht sagen kann/will. Irgendjemand von den immer gleichen Panikmacher-Kommentatoren/Schreibern bei GWUP, scienceblogs, scilogs, Volksverpetzer, müsste darauf doch mal eine Antwort haben oder zumindest mal eine Hypothese warum ihre kaum hinterfragten RKI-Zahlen zu Inzidenzen und Impfwirksamkeit simpelsten Plausibilitätsprüfungen im realen Leben nicht standhalten von Impfhochburgen bis zu Impfdurchbrüchen. Mitterweile sind über 60% geimpft, das Virus weniger gefährlich mutiert und die Inzidenzen bei neuen Rekorden und die Intensivmediziner schlagen schon wieder Alarm. Sie könnten einen Funken Glaubwürdigkeit zurückgewinnen hier, wenn Sie mal im Vergleich zum ÖRR plausibel erklären würden, wie es dazu überhaupt kommen konnte. Zumindest hätte man sich doch eine neue Virusmutation einfallen lassen könnte oder fallen keien griechischen Buchstaben mehr ein?

  102. Bevor wir uns in Klapperstorchstatistik verrennen und über kontrafaktische Argumentation sinieren:

    Wir haben eine Impfquote von 70% und noch 30% (meist unvorsichtigere) Ungeimpfte.
    Die Impfung ist “nicht steril”, nach 2-3 Monaten ist die Schleimhautimmunität faktisch weg.
    Wie soll die Impfquote mit der Infektionsinzidenz korrelieren, der Verdünnungsfaktor 70% reicht nicht.
    Wir haben eine Inzidenz von fast 200, aber ü70% entfallen auf 30% Ungeimpfte, da sehen wir es.
    Die Impfung schützt vor symptomatischer Erkrankung und Hospitalisation, diese Korrelation ist da.
    Außerdem sind wir in einer ansteigenden Welle, maßgeblich von den Ungeimpften favorisiert,
    da hilft nur Durchimpfung bis 90% und eine 3. Impfung, angefangen mit ü60 wegen Impfdurchbrüchen.

  103. Und wieder, nichts was sie beschreiben wollen/können Sie belegen oder ist plausibel…andere Länder sind schon längst mit geringen Impfquoten ausgestiegen und weniger Intensivbetten und keine Todeswellen. In Irland gibt es Distrikte mit über 95% Impfung und trotzdem höhcste Inzidenz, selbiges Hawai (siehe John Hopkins Server). Die Ungeimpften sind alle pauschal unvorsichtig (lach), könnte genauso gut wie bei mir andersrum sein und die treiben Sport und nehmen jeden Tag Vitamin D. Die feiern auch keine 2G Parties heimlich und Geimpfte müssen draussen bleiben. Ich könnte hier mehr Links aus Regionalzeitungsberichten posten als zugelassen wird in denen zu Dutzend Doppeltgeimpfte Bewohner von Altersheimen versterben. Aus all dem schliessen Sie noch mehr Öl ins Feuer zu giessen und 90% durchimpfen, irgendwann muss es ja ausgehen. Wir haben jetzt eine Pandemie der ungeimpften gesunden noch 30% die die Intensivbetten noch mehr an die Leistungsgrenze bringen wie letztes Jahr schon nicht. Man kann sich eigentlich nur noch streiten darüber ob das loriotesk oder kafkaesk ist…

    Ne Herr Senf, für Harvard reicht das leider nicht, nur für anonyme Panikmache auf den scilogs…

  104. @ Herr Senf,

    Wir haben eine Impfquote von 70% und noch 30% (meist unvorsichtigere) Ungeimpfte.

    Zu doof nur, dass eine weitere “Verschwörungstheorie” kurz davor ist, sich zu bewahrheiten, und Sie mit fehlendem Booster bald genauso entrechtet sind wie die vollständig Ungeimpften. Bald heißt es “Pandemie der Ungeimpften und Ungeboosterten”. Haben Sie sich mal gefragt, warum der Anteil der vollständig Geimpften auf den Intensivstationen in Israel über Nacht schlagartig gesunken ist?

  105. @Kuhn: Impfungen und Nebenwirkungen

    Danke erst einmal für den Link auf die neue epidemiologische Studie, die man beachten sollte.

    Tatsächlich ist mir nach den Impfungen mehrmals aufgefallen, dass das Herz mal “aus dem Takt” kommt. Das ist vor den Impfungen aber auch schon mal passiert.

    Die Herzstiftung schreibt hierzu:

    Das Risiko einer schweren (akuten) Herzschädigung ist bei einer Infektion mit dem Erreger SARS-CoV-2 offenbar merklich größer als bei einer Impfung mit einem mRNA-Impfstoff zum Schutz vor Covid-19. Das hat zum Beispiel die Auswertung der Daten von rund 1,7 Millionen Menschen mit und ohne Impfung aus Israel ergeben.

    Und spezifisch zu den Impfungen:

    Eine genaue Häufigkeit einer Myokarditis und/oder Perikarditis nach mRNA-Covid-19-Impfung kann bislang nicht sicher ermittelt werden, da epidemiologische (bevölkerungsbezogene) Studien fehlen. Allerdings scheint eine Myokarditis nach mRNA-Impfstoffen sehr selten zu sein. Nach PEI-Angaben kann zum Beispiel aus den US-Daten eine Häufigkeit von weniger als 1:100.000 Impfdosen abgeschätzt werden. Aus den israelischen Daten wurde eine grob kalkulierte Häufigkeit von etwa 2,4 Fällen pro 100.000 Personen nach einer zweiten Dosis Comirnaty errechnet. Zudem wurden 95 % der Fälle als mild beschrieben mit einem zumeist kurzen Krankenhausaufenthalt.

    Ich bin nach meiner zweiten Impfung noch tanzen gegangen und war den Abend müde, habe mich zweimal zwischendurch ausgeruht. Das muss ich sonst nicht machen. Mit dem Wissen von heute würde ich mich nach der Impfung für den Rest des Tages hinlegen – sicherheitshalber.

  106. @ Kuhn, Mutiertes Spike-Protein

    In einem Punkt würde ich Ihrer „Denkrichtung“ zustimmen. Es wird zu hoher psychischer Druck auf Ungeimpfte, z.B. auch auf Menschen ausgeübt, die durch einen Medikamentenschaden seit ihrer Kindheit relativ stark beeinträchtigt sind und sich nicht impfen lassen wollen.

    Auch wenn man berücksichtigt, dass es weitaus schlimmer hätte kommen können als bei Covid, die Maul und Klauenseuche z.B. haben ehemals rund 30 % der Rinder nicht überlebt, so meine ich halt doch, dass wir uns gegen eine Seuche wehren und sie nicht einfach hinnehmen sollten wie die wehrlosen „Haserl“. Noch dazu sind schwere Erkrankungen in der Vergangenheit durch Impfungen praktisch erfolgreich ausgerottet worden, was man den medizinischen Fortschritt verdanken kann.

    Auch ist naheliegend, dass die phantasievollen Juristen „Mord aus Unterlassung“ konstruieren könnten, wenn z.B. die Regierung nichts gegen die Seuche unternehmen würde, die angeordneten Maßnahmen eigentlich ein dringend erforderliches “Alibi“ der Regierenden sind.

    Ich bin sehr neugierig, ob z.B. der Brasilianischen Präsidenten Bolsonaro in einigen Jahren, wenn wie bei Politikern üblich abgerechnet wird, wegen Mordes vor Gericht geschleift wird?

  107. Es scheint mittlerweile die beiden grundsätzlichen Varianten zu geben, in Anbetracht der hier gemeinten “super-gefährlichen” (Kritiker orientieren sich gegensätzlich am allgemeinen wie für sie, einem sog. persönlichen Präferenzmodell folgend, individuell teils abweichend)Corona-Variante, sich entweder (x-fach) impfen (perpetuierend?) zu lassen (“gut”) oder sich alternativ dann “böse”, zu verweigern, dann (zunehmend auch) “konditioniert”.

    Mit freundlichen Grüßen
    Dr. Webbaer (der, schon ein wenig alter, sich seiner (!) Abwägung folgend wohl impfen gelassen hätte, sich nunmehr aber aus Trotz, der zentral politische Grundlage hat, lieber so anfällig wird, statt sich anzupassen – Dr. W war mal sog. Punk, Randbemerkung)

  108. @ Kommentatorenfreund “Elektroniker”

    Ihr Kommentatorenfreund ist genereller Impfbefürworter, hätte sich auch, altersbedingt sozusagen, wie gemeint impfen lassen, aber dieses (lange anhaltende, auch politisch, vs. medizinisch motivierte) Herumgerede, das offensichtlich oder nachweislich, partiell falsch war, diese falsche Ankündigung nach erfolgter Impfung, dann Doppelimpfung, dann sog. Booster meinend, perpetuiert, die Zeitabfolge, derart könnte allgemein klar sein, den avisisierten Zeitrahmen meinend gar : quartalsweise, also dafür hat Dr. Webbaer keine Zeit, hat auch nicht vor sich bis zu seinem Lebensende regelmäßig “boostern” (alleine schon die fkn Sprachlichkeit) einspritzen zu lassen, lieber stirbt er anders.

    Mit freundlichen Grüßen
    Dr. Webbaer (der auch gar nicht die Idee mag, dass sich da welche irgendwie quartalsweise und das angeblich Gute meinend in ihren Körper etwas reinzuspritzen haben, damit sozusagen alles, allgemein, gut wird,

  109. Dr. Webbaer
    08.11.2021, 14:54 Uhr = nunmehr aber aus Trotz
    Dr. Webbaer
    08.11.2021, 15:14 Uhr = lieber stirbt er anders

    “Chacun à son goût” sage ich da und “bonne chance”. Nach der Entscheidung gilt einfach “rien ne va plus”.

    C’est la vie, c’est la guerre.

  110. War inhaltlich (seinerseits) jetzt nicht so proper,
    Kommentatorenfreund ‘Karl Maier’,
    es darf auch gelegentlich auch ein wenig “nickelig” hervorgekommen werden.

    Mit freundlichen Grüßen
    Dr. Webbaer


    PS:
    Insgesamt, die jungen Leutz meinend, heutzutage,
    auch sog. Solidarität meinend, derart verpassend, dass hier Gemeinsamkeit gemeint ist, nicht also Veranstaltung im Rahmen sog. Solidarität.

  111. Dr. Webbaer
    08.11.2021, 15:52 Uhr

    Tja, wie man auch so sagt:

    “Es sucht keiner einen hinter der Tür, der nicht schon mal selber da gestanden hat.”

  112. Warum glaube ich immer noch, bei scilogs steht “Tagebücher der Wissenschaft” drüber?

  113. Herr Senf, ich überlege vorzuschlagen, es in “Tagebücher der Parawissenschaft ” umzubenennen. Es wird Impfspinnern und Leuten, die Tatsachen und Meinungen verwechseln zu viel Freiraum gegeben. Eigentlich sind einige Threads nur noch als Anschauungsmaterial für verschiedene geistige Verwirrungen zu gebrauchen, also nur noch wertvoll für Psychologen, die Feldforschung zu solchen Querspinnern betreiben.

  114. @ Physiker,

    Ich schließe mich dem an. Die “Impfspinner”, die an die ultimative Wirksamkeit ihrer Impfung glauben und sich gleichzeitig einreden lassen, sie müssen via Abo ihr Leben lang “boostern”, weil ihre Impfung nicht ultimativ wirksam ist, sind ein Fall für die Psychiatrie.

  115. @Spike-Protein: Spinnen und Spinner

    Wir wollen uns in diesem Blog nicht pauschal als “Impfspinner” oder “Impfleugner” titulieren. Das trägt nichts zur Verständigung bei.

    Allerdings horchte ich auch auf, als zuletzt bei Anne Will Ärztepräsident Montgomery, wenn ich mich recht erinnere, von ein bis zwei Booster-Impfungen pro Jahr sprach, um den Status “vollständig geimpft” zu behalten.

  116. Sehr geehrter Herr Schleim, Sie müssten es doch inzwischen gemerkt haben, dass jegliche Verständigung zwischen Leuten wie M-S-P und mir (nur zum Beispiel, es gibt ja glücklicherweise noch andere) unmöglich ist. Es fehlt bei den diesen Leuten einfach an elementaren Dingen, die für einen sinnvollen Diskurs nötig sind.

    Ich werde mir so schnell wie möglich die Booster-Impfung holen, und auch weitere, wenn sie nötig sind. Das habe ich bisher mit Tetanus so gemacht und anderen Impfungen die aufgefrischt werden mussten.
    Kleine Anmerkung zu Impfzwang: den gibt es längst, aber anders als viele es sich vorstellen: bis Ende des Winter werden alle eine Grundimmunität haben, die Mehrheit eben durch Impfung, und der Rest durch Delta. Oder sie haben eben die Immunität des Sargs. Na ja, wenn die Narren es so wollen…
    Die Leidtragenden sind nur in erster Linie das Personal der Krankenhäuser.

  117. Nur zur Klärung des Begriffs “Narren” (aus der Wikipedia geklaut).
    “Als Tor oder Narr werden auch Personen bezeichnet, die sich sehr unreif, dumm, tollpatschig, voreingenommen, vorurteilsbehaftet und ignorant verhalten und die sich auf Basis ihrer Unwissenheit als Gelehrte aufplustern, ohne ihre Unwissenheit zu erkennen, weil sie denken, ihre Unwissenheit sei großes Wissen.”

    Gute Umschreibung für einige der Foristen hier und in anderen Threads.

  118. @Physiker: In- und Outgroup

    Zufälligerweise habe ich gerade einen Podcast gehört, in dem jemand aus dem Mathematikstudium erzählte: Kommilitonen seien zum Spaß in Physikvorlesungen gegangen und hätten aus der letzten Reihe herzlich darüber gelacht, wie “die Physiker” mit Zahlen umgehen.

    So hat jeder sein Grüppchen, über das er sich erhaben fühlt. Wer’s braucht…

  119. Der Grund, wieso die Impüfung gegen Corona nicht so erfüllend immunisiert, ist, das dieses Virus natürlich Teil des Lebens ist und erst dann unschädlich sein wird, wenn der Teil des Lebens, aus dem das Virus stammt, auch tot ist und sein Leben nicht mehr zur Aufrechterhaltung des Virus fungiert.

    Insofern ist es etwas anders, als mit den Masern. Abgesehen davon, das die Virus-These auch so einige Schwachstellen hat.

    Anyway, die Lösung wäre also, tatsächlich 99 % mit mehrfachimpfungen zu immunisieren, weswegen die gerade immer mehr radikal immer mehr Impfung verlangen. Und es soweit geht, das es zwar keine konkrete Impfpflicht gibt, aber hintenrum ein Zwang dazu konstruiert wird, weil etwa auch gesetze verabschiedet werden, das die 3g Formel am Arbeitsplatz gelten soll, was darauf hinauslaufen würde, das ungeimpfte nicht meh rihren Lebensunterhalt erarbeiten könnten.

    Eindeutige Impfpflicht durch die Hintertür…strukturell erzwungene Pflicht. So funktioniert in der modernen, freiheitlichen Demokratie nahezu alles andere auch. Vorne Freiheit, hintenrum unhintergehbare Unfreiheit.

    Aber es geht hier eben nicht um Freiheitseinschränkung, sondern um Mord. Denn wenn das Virus Teil eines Lebewesens ist (und ungünstigerweise eines Menschen auch noch), dann ist davon auszugehen, das bei vollendeter Massendurchimpfung womöglich diese Menschen sterben werden.

    es gibt für diese Systematik keine beispielhafte Entsprechung in der Welt. Sie ist so einzigartig und grundlegend, das sie meist absolu tnicht als einflussreich erkannt wird oder gar nicht erst als bestehend erkannt wird. Aber Leben organisiert sich immer kollektiv, und die Menschen sind alle miteinander verschränkt, sodass aus dem Kollektiv erst Lebenskraft und überlebensfähigkeit hervorgeht.

    Aber wenn nun, wie gegenwärtig der Fall, grundlegende Verwurzellungen dieser Menschheit zerstört wurden, dann brechen Seuchen aus, weil sich der Stammbauzm der Menschheitsverwandtschaften neu sortiert und die vertikale verschränkung zum Problem wird, weil neue Primaten anstelle der alten, aber optimal passenden anstelle kommen und “Abstoßungsreaktionen” etwa durch genetische Unterschiede, daraus hervorgehen.

    Seitdem man Gene eindeutig analysieren kann, ist man sich über solche Wechselwirkungen sicher nicht unebwusst. Und man scheint in einer Art Torschlußpanik das Problem totschlagen wollen und die Massenimpfung solange weiter machen und erneuern will, bis das Problem eben aus der Welt ist. Und das problem ist womöglich, das bei solchen Pandemien immer eine Konfrotnation besteht, die weder durch Impfung, noch durch andere Maßnahmen entdramatisierbar ist. Denn sie hat ganz andere Ursachen, als das Virus uns erklären kann. Wenn dem Virus ein lebendiges Genom als Grundlage zugrunde liegt, dann ist die Tötung des Virusses mit der Tötung des Lebewesens unweigerlich verknüpft.

    Und die Frage ist hier nun, ob man zur Rettung einiger, einige Andere “opfern” (töten) darf. Und nach aller guten Ethik ist diese Frage mit “Nein” zu beantworten. Denn das war und ist immernoch die einzige Rechtfertigugng von Zivilisation und moderner Gesellschaft: genau diesen Ausgleich zwischen Leben und Leben lassen zu finden, damit des einen leben nicht davon abhängt, das wer anderes stirbt. Und manchmal scheint es so zu sein, das es keinen schadlosen Ausweg gibt. Es kann auch daran erkannt werden, das vor allem ältere Menschen gefärdet sind. Jüngere eher weniger gefärdet, aber nicht immun.
    Hier ist offenbar die “Biofittnes” der Faktor, der bei alten Menschen dazu führt, das sie sich nicht an die neue Situation hinreichend funktiinal anpassen können, wie bei jungen Menschen.

  120. @ Physiker,

    wer die Narren sind, werden die nächsten Jahre entscheiden. Ich glaube, die Menschen in Schweden und Florida kennen bereits die Antwort. Und ja, wer kennt sie nicht, die Tetanus-Impfung, die alle sechs Monate aufgefrischt wird und ohne die man nicht ins Restaurant kommt.

  121. Zitat: “Allerdings horchte ich auch auf, als zuletzt bei Anne Will Ärztepräsident Montgomery, wenn ich mich recht erinnere, von ein bis zwei Booster-Impfungen pro Jahr sprach, um den Status “vollständig geimpft” zu behalten.”

    Eine Gemeinsamkeit haben Geimpfte und Ungeimpfte jedenfalls: Beide werden nie vollständig geimpft sein.

    Mit den Boosterimpfungen kann man sich lediglich ein paar Monate “Freiheit” erkaufen, die in der Praxis jedoch überhaupt keine echte Freiheit ist, sondern nur etwas weniger Gängelungen bedeutet.

  122. Singapur mit 5,7 Mio Einwohnern (wie Dänemark) macht ab 8. Dezember ernst.
    86% sind geimpft, aus der Gruppe der 14% Ungeimpften werden die Krankenhäuser gefüllt.
    Der Staat wird die Behandlungskosten für die Unbelehrbaren nicht mehr übernehmen.
    https://www.rnd.de/politik/corona-in-singapur-ungeimpfte-zahlen-fuer-die-intensivstation-kuenftig-selbst-DNNHW3LHINFHPDURZM5H37L4QU.html

    Der Anteil Ungeimpfter in stationärer Behandlung in Deutschland beträgt laut IfW derzeit 84,5%.
    Bei Jüngeren, die länger und intensiver liegen, um sie zu retten, gehen die Kosten auf 77.000€ hoch.

  123. In Irland gibt es Distrikte mit über 95% Impfung und trotzdem höhcste Inzidenz,

    Solange da keine konkreten Belege zur Impfquote und Inzidenz nachgereicht werden, nehme ich mal an dass es sich hier mal wieder um reine Verschwörungsmystik handelt.

    Für Deutschland kann man diesen Zusammenhang zum Beispiel im ARD-Text nach vollziehen und zwar indem man die Zahlen der einzelnen Bundesländer miteinander vergleicht Hier hab ich die Vorgehensweise beschrieben.

    https://umwelt-wissenschaft.de/forum/neues-aus-der-wissenschaft-und-forschung/4737-veranschaulichung-der-impfeffektivitaet?start=60#96693

  124. @ Julian Apostata,

    https://www.irishtimes.com/news/health/waterford-city-district-has-state-s-highest-rate-of-covid-19-infections-1.4707344

    Die Quellen sind die staatlichen Behörden Irlands.

    The adjacent electoral area of Tramore-Waterford City West has a 14-day rate of 1,121 per 100,000, according to the latest weekly figures published by the Health Service Executive’s Health Protection Surveillance Centre.

    Waterford has the highest rate of vaccination in the country with 99.7 per cent of adults over the age of 18 (as registered in the last census) fully vaccinated. The county has gone from having one of the lowest rates of Covid-19 infection in Ireland to one of the highest.

  125. Zitat Stephan Schleim:

    Mein Vorschlag lief darauf hinaus, erwachsene Menschen … für die finanziellen Folgen ihrer Entscheidung verantwortlich zu machen

    Gemäss SPON Söder fordert Beschluss bundesweiter 2G-Regeln und Unterabschnitt Schweizer Professor schlägt Zusatzversicherung für Ungeimpfte vor meint
    Marius Brülhart, Professor an der Universität Lausanne (per Radio).

    Wer sich gegen das Coronavirus impfen lassen könne, dies aber ablehne, könne ja eine Zusatzversicherung abschließen. Auch bei Unfallversicherungen gebe es das Prinzip, dass Menschen, die Risikosportarten nachgingen, stärker an Kosten beteiligt würden oder das zusätzliche Risiko versicherten.

    Weiter liest man da:

    In Singapur müssen ab dem 8. Dezember Menschen, die eine Corona-Impfung aus freien Stücken ablehnen, bei einer Infektion im Fall nötiger Krankenhauspflege selbst für die Kosten aufkommen.

    Nun, das passt zu Singapur und seinen strengen Regeln zum Verhalten in der Öffentlichkeit. Auf der Toilette nicht spülen, in der eigenen Wohnung nackt sein, Kaugummi dabei haben oder Spucken – dafür kann man in Singapur bestraft werden.
    Wer sich nicht richtig verhält, wird in Singapur schnell einmal bestraft. Die Krankenhauskosten selber berappen zu müssen kann da sogar als mindere Form der Bestrafung aufgefasst werden.

  126. ard-text.de
    Folgende Tabelle hab ich mit Hilfe der Tafeln 576 und 573 erstellt.
    Erste Spalte die Impfquote und zweite Spalte die Siebentageinzidenz. Die Tabelle ist nach Impfquote aufwärts sortiert.

    Sachsen___________________57,3_______521.1
    Brandenburg_______________61,1_______285,7
    Thüringen_________________61,3_______469,2
    Sachsen-Anhalt_____________63,7_______232,5
    Bayern____________________65,3_______427,4
    Baden-Württemberg__ _______65,4_______316,0
    Mecklenburg-Vorpommern____65,7_______162,3
    Hessen____________________66,5_______164,3
    Rheinland-Pfalz_____________67,2_______159,3
    Berlin_____________________67,7_______263,4
    Niedersachsen______________69,2_______105,5
    Nordrhein-Westfalen___ _____70,8_______154,3
    Schleswig-Holstein__________71,9_______89,4
    Hamburg__________________72,8_______135,0
    Saarland___________________73,9_______152,1
    Bremen____________________79,0_______92,3

    Und man sieht: Oberhalb McPomm sind die Inzidenzen > 200 und darunter <200 außer Berlin. Und dass die letzten 3 Stadtstaaten so gut da stehen, das kann ja wohl nur an der hohen Impfquote liegen.

  127. Herzlichen Dank, @Stefan Schleim; ich teile Ihren Beitrag vollinhaltlich und sehe die mangende Impfbereitschaft zumindest bei Jungen und Gesunden als ein Problem einer mangelnden Solidarität oder – anders formuliert – eines erschreckenden Narzissmus und Egoismus in unserer Gesellschaft.

    Aber, wenn man schon die Impfquoten veröffentlicht und vergleicht, geehrter @Julian Apostata, sollte man auch die Fakten, auf denen diese beruhen, nicht ganz außer Acht lassen.
    Ich selbst lebe in Sachsen, dem Land mit der niedrigsten Impfquote. Eine Seite der Medaille ist sicherlich jene, dass rechte AfD-Anhänger oder – teilweise nach der Wende in höhere Beamtenjobs aus Baden-Württemberg importierte – esoterische Rudolf-Steiner-Apologeten (die Grenzen sind hier wohl fließend) eine Impfung aus irrationalen unwissenschaftlichen Erwägungen heraus ablehnen.
    Doch ist es aktuell so, dass es unter dem Druck katastrophaler Inzidenzen sehr viele impfwillige Sächsinnen und Sachsen gibt, jedoch derzeit eben nicht genügend Angebote.
    So stellte die sächsische Landesärztekammer vor einigen Tagen fest, man habe den “Worst Case in der Pandemie erreicht”.
    Nachdem das Gesundheitswesen dank neoliberaler, profitorientierter und damit verantwortungsloser Gesundheitspolitik in den letzten Jahren kaputtgespart, die Impfzentren überdies im Sommer kurzsichtig geschlossen worden sind, sind die Krankenhäuser, insbesondere die Intensivstationen massiv überlastet.
    In einem offenen Brief des Mobilen Impfteams Dresen heißt es ebenso resignierend wie nachvollziehbar:
    “Der Unmut über den Zynismus der zur Impfung aufrufenden Politik und der mangelnden Verfügbarkeit an Impfangeboten bricht sich über unseren Köpfen”.

    Insofern wirken die Aufrufe und Appelle des CDU-Ministerpräsidenten doch zum Teil höhnisch. Sie sind vergleichbar mit seinen im Rufen nach einer neuen “Mauer” gegenüber Flüchtlingen und Hilfesuchenden an der polnischen Grenze offenbarten Menschenbild. Und sie erinnern erschreckend an das Jahr 2016, in dem AfD-Politikerinnen und AfD-Politiker gefordert hatten, die Grenze notfalls mit Waffengewalt zu “verteidigen”.
    Vor wenigen Tagen wurde von Warnschüssen und Toten (u.a. eines 14jährigen Jungen) an der Grenze zwischen Polen und Belarus berichtet, was gleichwohl Politikerinnen und Politiker, aber auch “bürgerliche” Journalistinnen und Journalisten nicht davon abhält, Schutzsuchende aus Afghanistan, Syrien oder dem Irak als “Invasoren” und “Waffen” zu bezeichnen.

    Letztlich beweist sich eine ebenso frühe wie gleichwohl immer wieder karikierte Erkenntnis: “… es ist der allvermögende Egoismus, der bis zum Widersinn und zur Unvernunft gehegte und gepflegte Trieb der Selbsterhaltung, der um des Lebens vergessen macht, warum man lebt.” Georg Forster, Kleine Schriften, Parisische Umrisse, Leipzig 1964, S. 247.

Schreibe einen Kommentar